PREDICTED: Stomoxys calcitrans uncharacterized LOC131997014

LOCUS       XM_059367253             627 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997014), mRNA.
ACCESSION   XM_059367253
VERSION     XM_059367253.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..627
                     /gene="LOC131997014"
                     /note="uncharacterized LOC131997014; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997014"
     CDS             1..627
                     /gene="LOC131997014"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997014"
                     /protein_id="XP_059223236.1"
                     /db_xref="GeneID:131997014"
                     /translation="MASLSADLKSHMDSALAEMNRNVATIAAQVSELQKKDQEKTVQI
                     GELTKRLQQLEQKALEKNIEINNVENMETEPEVIVKRITDALGVDMSAEHISKMYKIK
                     RKKKVVVEFASLNKKKEFMGKLKGHRIQASVLREEENSDCGGYIYINDELTPHNRQIL
                     WAAKTKAKENGWKFVWVRNGHIYARRNENSSFIIINNASELELITESS"
ORIGIN      
        1 atggcatcgc taagtgctga tctgaagtcg catatggact ctgcattagc cgagatgaac
       61 cgaaacgtag cgactattgc agcacaagtg tctgaactgc aaaagaaaga ccaagagaaa
      121 acggtacaaa ttggtgaact tacaaaacga ttacaacaac ttgaacaaaa agcattagaa
      181 aaaaatattg aaattaacaa tgtagagaac atggaaacag agcctgaagt tattgttaag
      241 agaataactg atgctctcgg cgtggatatg agtgcagaac acattagtaa aatgtataaa
      301 ataaagcgca agaaaaaagt tgttgtggaa tttgcatctc tgaacaagaa aaaagagttt
      361 atgggtaaac taaagggtca tcgcatacaa gcaagcgtgt tgagagaaga agaaaacagc
      421 gactgtggag gatacatata cataaatgat gaacttacac cgcacaatag acaaatttta
      481 tgggccgcaa aaacaaaggc caaagaaaat ggatggaaat ttgtttgggt gcgaaatggg
      541 cacatttatg ctcgcagaaa tgaaaattct tcctttataa taattaataa tgcatcagag
      601 ttggaactaa taaccgaatc aagttaa