PREDICTED: Stomoxys calcitrans farnesol dehydrogenase-like

LOCUS       XM_059367251             720 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089533), partial mRNA.
ACCESSION   XM_059367251
VERSION     XM_059367251.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 70% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..720
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..720
                     /gene="LOC106089533"
                     /note="farnesol dehydrogenase-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106089533"
     CDS             <1..720
                     /gene="LOC106089533"
                     /codon_start=1
                     /product="farnesol dehydrogenase-like"
                     /protein_id="XP_059223234.1"
                     /db_xref="GeneID:106089533"
                     /translation="ISVDRTSLKIAVVTGASKGIGAAIVHCLLKNGIRVVGLSRSVEN
                     MEEFRNGLPLELQPLLSALKCNVGDVECVNKTFDEIERKHGGIDILVNSAGTMNPNLL
                     LTGDVAGMQEVLQTNVLGVIHCTQKAFSSMRQRKFDGHVFILNSILGHPIPIFPKDIS
                     SMLGMYIASKWAIKALTEYYRQEFRHFDTKIKVTLCDNIFRWYFLNANDIAESFLYAL
                     ATPPHVQIHEVTVKPVAEFIV"
ORIGIN      
        1 atatcagtgg accgtacttc tttaaagata gctgttgtga ccggggctag caaaggcatt
       61 ggtgctgcca tagttcactg tcttcttaag aatggcattc gagttgttgg cctctcaaga
      121 agtgttgaaa atatggagga gtttcgtaat gggttacccc ttgaattaca acccctgtta
      181 agtgccctta aatgcaatgt aggtgatgta gaatgtgtca ataagacatt cgatgaaata
      241 gaacgtaagc atggtggtat cgatattctt gtaaattctg ccggaactat gaatcctaat
      301 ttattgctca ccggcgatgt ggctggcatg caagaagttc ttcagacaaa tgtattgggc
      361 gtgatacatt gtacccaaaa agctttctca tcgatgaggc agcgaaaatt cgatggtcat
      421 gtcttcattt tgaacagcat cttgggccac cctataccaa tttttcccaa ggacatttca
      481 tcaatgttgg gcatgtacat agcctccaaa tgggccataa aggcattaac ggaatattat
      541 cggcaagaat ttcggcattt tgatacaaag atcaaagtta cgctatgcga taacatattc
      601 agatggtatt ttttgaatgc caatgacata gcagaaagtt ttctatatgc cttagctact
      661 ccaccccatg tgcagataca tgaagttaca gttaaacctg tggcggagtt catagtttaa