PREDICTED: Stomoxys calcitrans sodium/potassium/calcium exchanger

LOCUS       XM_059367248             510 bp    mRNA    linear   INV 02-SEP-2023
            1-like (LOC131997009), mRNA.
ACCESSION   XM_059367248
VERSION     XM_059367248.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..510
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..510
                     /gene="LOC131997009"
                     /note="sodium/potassium/calcium exchanger 1-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:131997009"
     CDS             1..510
                     /gene="LOC131997009"
                     /codon_start=1
                     /product="sodium/potassium/calcium exchanger 1-like"
                     /protein_id="XP_059223231.1"
                     /db_xref="GeneID:131997009"
                     /translation="MGLSGTLRSIKGLAVEANEFGINQRTGDVPQKHEYGGAQALGVE
                     GVEVESGEVEGGEVEGGEVEGGEVEGGEVEGGEVEGGEVEGGEVEGGEVEGGEVEGGE
                     VEGGEVEGGEVEGGEVEDGEVEGSEVEGGEVEGGEVDGGEVEGGEVEGGEVEGGEVEG
                     GEVEGGFVY"
ORIGIN      
        1 atgggactct caggtacttt gaggagcata aaggggttgg ctgtagaagc taatgagttt
       61 ggcataaacc aaagaactgg tgatgttccc cagaaacatg agtatggcgg cgctcaagcc
      121 cttggggtcg agggtgttga ggtcgagagt ggtgaggtcg agggtggtga ggtcgagggt
      181 ggtgaggtcg agggtggtga agtcgagggt ggtgaggtcg agggtggtga ggtcgagggt
      241 ggtgaggtcg agggtggtga ggtcgagggt ggtgaggtcg agggtggtga ggtcgagggt
      301 ggtgaggtcg agggtggtga ggtcgagggt ggtgaggtcg agggtggtga ggtcgaggat
      361 ggtgaggttg aaggtagtga ggtcgagggt ggtgaggtcg agggtggtga ggtcgatggt
      421 ggtgaggtcg agggtggtga ggtcgagggt ggtgaggtcg agggtggtga ggtcgagggt
      481 ggtgaggtcg agggtggttt tgtttactaa