PREDICTED: Stomoxys calcitrans uncharacterized LOC131997006

LOCUS       XM_059367245             423 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997006), mRNA.
ACCESSION   XM_059367245
VERSION     XM_059367245.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..423
                     /gene="LOC131997006"
                     /note="uncharacterized LOC131997006; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997006"
     CDS             1..423
                     /gene="LOC131997006"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997006"
                     /protein_id="XP_059223228.1"
                     /db_xref="GeneID:131997006"
                     /translation="MFSILIFALLVNFNQIIHINAQCRRYEIYYNSSLSPTCDVNCQD
                     LQRPCRLTTQSPQPGCYCQANYARNLRQQCIPRSECSRDCFPNESPIAPLSRSCERIC
                     RLRPNTMPISICYRQSERLCVCDAAYCRNRNGQCQRGN"
ORIGIN      
        1 atgttttcaa tattgatttt cgcattgctc gtaaatttca atcaaataat ccacataaac
       61 gctcaatgtc gacgatatga aatttattat aactcctcgc tatcgcccac atgtgatgtt
      121 aactgccagg atttacaacg tccatgtcgt ttgaccacac aaagtcctca gccgggttgt
      181 tattgccaag caaattatgc gcgcaatctg cgtcaacagt gtataccacg atcagaatgc
      241 tctcgtgact gtttccccaa tgaaagtcca attgctccct tgagtagaag ttgcgaaaga
      301 atttgtcgct tgaggccaaa tacaatgccc ataagtattt gctatcgcca gtcggagaga
      361 ctttgtgttt gtgacgcagc atattgccgc aaccgcaatg gtcaatgcca aaggggcaac
      421 taa