Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997005


LOCUS       XM_059367244             486 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997005), mRNA.
ACCESSION   XM_059367244
VERSION     XM_059367244.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..486
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..486
                     /gene="LOC131997005"
                     /note="uncharacterized LOC131997005; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997005"
     CDS             1..423
                     /gene="LOC131997005"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997005"
                     /protein_id="XP_059223227.1"
                     /db_xref="GeneID:131997005"
                     /translation="MNLYSALFLYGFIKAGFYSKRGLLSYEKHLRKHIAAFYFRLYLQ
                     TEKMKLLFIAFCIVLLALNVADSIPVDGVLCPIGKNEVFLELGPNCDRHCKTLNEPCI
                     KKGEPHRTGCFCRNGFARDDDNECVAIILCGRLQNSLR"
     polyA_site      486
                     /gene="LOC131997005"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgaatttgt attccgctct ctttctatac ggattcataa aagctggttt ctattcaaag
       61 cgaggcttat tatcgtacga aaaacacttg cgtaaacaca ttgcggcgtt ctattttcgg
      121 ttatatttac aaactgaaaa gatgaaatta ttattcatag ccttttgcat agtgttattg
      181 gctttaaatg ttgccgattc cattccagtc gatggcgttc tctgccccat tggcaaaaat
      241 gaggtcttcc tagagctggg accgaattgt gatcgacatt gtaagaccct caatgaaccc
      301 tgcatcaaga agggtgaacc tcatcgcaca ggctgctttt gccgtaatgg ttttgcacgc
      361 gatgacgaca acgagtgtgt ggctataata ttatgcggta gattgcagaa ctctttgaga
      421 tgaggatgaa tatgagattt gttttgataa gagttataga aataaaataa aattataatg
      481 aaatta