PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_059367227             726 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996998), mRNA.
ACCESSION   XM_059367227
VERSION     XM_059367227.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..726
                     /gene="LOC131996998"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996998"
     CDS             1..726
                     /gene="LOC131996998"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_059223210.1"
                     /db_xref="GeneID:131996998"
                     /translation="MTISILKYLAGIVEYNPPHLWIGLHDNLNTAETLKRPFFSIVDG
                     SQIKFSYWNNGEPNNALYSEHCTHIGMANNFKWNDDKCEKKFGYICEKPQAPVNISCD
                     LNETRKTVYQLNEGLAKDHKNNQEEVQGMLNDNRLQTQSVLQEWQKSSQKSLNESQKS
                     INDIFASKPYLQAVIADVGQPIKQIIREAYNEIAQFSHEAQQAIDGNSVDTQTSIMNK
                     SHAFQQKLEENTNGVDGLLAEHE"
ORIGIN      
        1 atgaccatat cgattctaaa atatcttgcg ggaattgtag aatataatcc accacatctt
       61 tggattggtc ttcacgataa tctcaataca gcggaaacac ttaaacgccc attcttctca
      121 atagtggatg gatctcaaat caaatttagc tattggaata atggagaacc caataatgct
      181 ttatactccg aacactgtac ccacataggt atggcgaata attttaaatg gaatgatgat
      241 aaatgtgaaa agaaatttgg ttatatttgt gagaaacccc aagcacccgt gaatattagc
      301 tgtgacttaa acgaaactcg aaaaactgtc taccagttaa atgaaggact tgcaaaggat
      361 cataaaaata atcaagaaga agttcaagga atgttaaacg ataatcgttt acaaactcaa
      421 agtgttttac aagaatggca gaaatcttcg cagaaatctt taaatgaatc tcaaaaatcc
      481 attaatgata ttttcgcaag caagccatat ctgcaagcag taatcgccga tgttggccaa
      541 ccaattaagc agatcattcg tgaagcttac aatgaaatag ctcagttttc ccacgaagct
      601 caacaagcaa tcgatggcaa ttccgtggat acacaaacat ccataatgaa caaatcgcat
      661 gcatttcagc aaaaattgga agaaaataca aatggtgttg atggcttact agcggagcat
      721 gaatag