Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367226 933 bp mRNA linear INV 02-SEP-2023 (LOC131996997), mRNA. ACCESSION XM_059367226 VERSION XM_059367226.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..933 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..933 /gene="LOC131996997" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131996997" CDS 1..933 /gene="LOC131996997" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_059223209.1" /db_xref="GeneID:131996997" /translation="MNFSMRNISWILASLLVGISMRVTAVPQSHTANDGTVYIIEQEQ AYNWIQAHTECVRQELQFAVIDSSEKNKAFKALLLQIFDITPQLWIGHHDNLNKAETL NRKFYSLVDGSEIKFSNWHKGEPNHQLNKEHCVHIGRWKDDEWNDGFCDNKIGYVCEK PQKFSNVSCDFTETRMGIYELNQELSNDHENHENEVQGMLNANRIRTQSVLHEWQQSS LQTLEKSQKSINDIFAKKPYLNAVIADVGPPIKQIIREAYNEIAQFSHEAQQTIDGNG VDTQTSIMDNSKEFRQKLDENTKTVDGLLAQHAL" ORIGIN 1 atgaatttct caatgcggaa tatttcttgg attttggcca gcttgctggt aggaatatcc 61 atgcgtgtga ctgccgtccc tcaatcacat accgcaaatg atggcacagt atatataata 121 gaacaggaac aagcctacaa ttggatacag gcccataccg aatgtgttcg tcaagaattg 181 cagtttgccg ttatagatag ctctgaaaaa aacaaagctt ttaaggcatt actactacaa 241 atattcgata taacaccaca actatggatt ggacatcatg ataaccttaa taaagcagaa 301 acactaaatc gtaaatttta ctcactagtc gatggatcgg aaataaaatt ttccaattgg 361 cataagggtg aaccgaatca tcaactcaat aaagaacatt gtgtccacat tggtcgatgg 421 aaggatgacg agtggaatga tggtttttgt gataacaaaa ttggttatgt ttgcgagaaa 481 ccccaaaagt tctcaaatgt tagttgtgat ttcacagaaa ctcgcatggg tatctatgaa 541 ttaaatcaag aactttcaaa tgatcatgaa aatcatgaga atgaagtaca aggaatgctt 601 aacgctaatc gtatacgaac tcaaagtgtt ttgcacgaat ggcagcagtc ttcgctgcaa 661 actttggaga aatcacaaaa atccattaat gatattttcg caaagaagcc atatctgaac 721 gctgttattg ccgatgtcgg cccaccaatt aagcagataa ttcgtgaagc ttataatgaa 781 atagcgcagt tttcccacga ggctcagcag acaattgatg gcaatggtgt ggatacacaa 841 acatccatta tggataattc taaagaattc cgccaaaagt tagatgaaaa tacaaaaact 901 gtggatggct tacttgccca gcatgcattg tag