Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_059367226             933 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996997), mRNA.
ACCESSION   XM_059367226
VERSION     XM_059367226.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..933
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..933
                     /gene="LOC131996997"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996997"
     CDS             1..933
                     /gene="LOC131996997"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_059223209.1"
                     /db_xref="GeneID:131996997"
                     /translation="MNFSMRNISWILASLLVGISMRVTAVPQSHTANDGTVYIIEQEQ
                     AYNWIQAHTECVRQELQFAVIDSSEKNKAFKALLLQIFDITPQLWIGHHDNLNKAETL
                     NRKFYSLVDGSEIKFSNWHKGEPNHQLNKEHCVHIGRWKDDEWNDGFCDNKIGYVCEK
                     PQKFSNVSCDFTETRMGIYELNQELSNDHENHENEVQGMLNANRIRTQSVLHEWQQSS
                     LQTLEKSQKSINDIFAKKPYLNAVIADVGPPIKQIIREAYNEIAQFSHEAQQTIDGNG
                     VDTQTSIMDNSKEFRQKLDENTKTVDGLLAQHAL"
ORIGIN      
        1 atgaatttct caatgcggaa tatttcttgg attttggcca gcttgctggt aggaatatcc
       61 atgcgtgtga ctgccgtccc tcaatcacat accgcaaatg atggcacagt atatataata
      121 gaacaggaac aagcctacaa ttggatacag gcccataccg aatgtgttcg tcaagaattg
      181 cagtttgccg ttatagatag ctctgaaaaa aacaaagctt ttaaggcatt actactacaa
      241 atattcgata taacaccaca actatggatt ggacatcatg ataaccttaa taaagcagaa
      301 acactaaatc gtaaatttta ctcactagtc gatggatcgg aaataaaatt ttccaattgg
      361 cataagggtg aaccgaatca tcaactcaat aaagaacatt gtgtccacat tggtcgatgg
      421 aaggatgacg agtggaatga tggtttttgt gataacaaaa ttggttatgt ttgcgagaaa
      481 ccccaaaagt tctcaaatgt tagttgtgat ttcacagaaa ctcgcatggg tatctatgaa
      541 ttaaatcaag aactttcaaa tgatcatgaa aatcatgaga atgaagtaca aggaatgctt
      601 aacgctaatc gtatacgaac tcaaagtgtt ttgcacgaat ggcagcagtc ttcgctgcaa
      661 actttggaga aatcacaaaa atccattaat gatattttcg caaagaagcc atatctgaac
      721 gctgttattg ccgatgtcgg cccaccaatt aagcagataa ttcgtgaagc ttataatgaa
      781 atagcgcagt tttcccacga ggctcagcag acaattgatg gcaatggtgt ggatacacaa
      841 acatccatta tggataattc taaagaattc cgccaaaagt tagatgaaaa tacaaaaact
      901 gtggatggct tacttgccca gcatgcattg tag