Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367221 956 bp mRNA linear INV 02-SEP-2023 (LOC106088950), mRNA. ACCESSION XM_059367221 VERSION XM_059367221.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 4% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..956 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..956 /gene="LOC106088950" /note="uncharacterized LOC106088950; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088950" CDS 1..828 /gene="LOC106088950" /codon_start=1 /product="uncharacterized protein LOC106088950" /protein_id="XP_059223204.1" /db_xref="GeneID:106088950" /translation="MNSNNRTKNHFENDSDDPPVPKPRQRTLKDLENINKGTRAVKFT SDGRKVQIPLDYNAIADIFPSMDHKAMGDNNLKAIENEPGCPIPSIDPKLLSVKEHPK ELLAPENNVKDTPRSRALKHAEHLESCNLSLCTDDETPTQDHTFTIENIQTQTDETFY HLMPCYHSTFVRNGPQSHSTPMLAVIGSKDYQFSLSPKQSKTKKLTLCFIILWLILSQ IYIFLNIMSWLLQIDLQMDFSSHLNKFVKPHFWYREEIEMPKTSTQLLLDFFKSLWS" polyA_site 956 /gene="LOC106088950" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgaattcca ataatcgtac caaaaaccat tttgaaaatg attccgacga tccaccggtg 61 cccaagccac gccaacgtac cttgaaagat ttggaaaaca tcaataaagg aactcgtgcg 121 gttaaattta cctcagacgg taggaaggta caaattcctt tggattataa tgccatagca 181 gacatttttc catccatgga ccataaggca atgggcgata ataatttgaa ggcaatagaa 241 aacgaacctg gttgtcccat cccatcaatc gacccaaagc ttctttcggt taaagaacac 301 ccaaaggagt tacttgcacc agaaaataat gtcaaagata ctccacgttc acgagccctt 361 aaacatgccg aacatttgga atcttgcaat ttgagccttt gcactgatga tgaaactccc 421 acccaagatc atacctttac tattgaaaat atacaaacac aaacggatga aaccttttac 481 caccttatgc cttgttatca ttcaactttt gttcgaaatg ggccgcaaag tcattctacc 541 ccaatgttgg ctgtaatcgg ttcaaaggat taccaatttt cattgtcacc aaaacaatca 601 aagacaaaaa aattaaccct gtgttttata attctttggc tcatcctttc acaaatttat 661 attttcctca atattatgtc atggctctta caaattgatc ttcaaatgga cttttcctca 721 catttaaata agtttgtcaa accacatttt tggtatcgtg aagaaataga aatgccaaag 781 acatcaacgc aacttctgct ggattttttc aagagcttat ggtcttgagc aataaattgt 841 ttaccaactg tttttatata ttttatagta attgaattag agaattaaat ataatgcata 901 ttgattatat ttttgttaag aactggatat aaatgaactt aattttgaat ctctta