Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088950


LOCUS       XM_059367221             956 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088950), mRNA.
ACCESSION   XM_059367221
VERSION     XM_059367221.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 4% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..956
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..956
                     /gene="LOC106088950"
                     /note="uncharacterized LOC106088950; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088950"
     CDS             1..828
                     /gene="LOC106088950"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088950"
                     /protein_id="XP_059223204.1"
                     /db_xref="GeneID:106088950"
                     /translation="MNSNNRTKNHFENDSDDPPVPKPRQRTLKDLENINKGTRAVKFT
                     SDGRKVQIPLDYNAIADIFPSMDHKAMGDNNLKAIENEPGCPIPSIDPKLLSVKEHPK
                     ELLAPENNVKDTPRSRALKHAEHLESCNLSLCTDDETPTQDHTFTIENIQTQTDETFY
                     HLMPCYHSTFVRNGPQSHSTPMLAVIGSKDYQFSLSPKQSKTKKLTLCFIILWLILSQ
                     IYIFLNIMSWLLQIDLQMDFSSHLNKFVKPHFWYREEIEMPKTSTQLLLDFFKSLWS"
     polyA_site      956
                     /gene="LOC106088950"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgaattcca ataatcgtac caaaaaccat tttgaaaatg attccgacga tccaccggtg
       61 cccaagccac gccaacgtac cttgaaagat ttggaaaaca tcaataaagg aactcgtgcg
      121 gttaaattta cctcagacgg taggaaggta caaattcctt tggattataa tgccatagca
      181 gacatttttc catccatgga ccataaggca atgggcgata ataatttgaa ggcaatagaa
      241 aacgaacctg gttgtcccat cccatcaatc gacccaaagc ttctttcggt taaagaacac
      301 ccaaaggagt tacttgcacc agaaaataat gtcaaagata ctccacgttc acgagccctt
      361 aaacatgccg aacatttgga atcttgcaat ttgagccttt gcactgatga tgaaactccc
      421 acccaagatc atacctttac tattgaaaat atacaaacac aaacggatga aaccttttac
      481 caccttatgc cttgttatca ttcaactttt gttcgaaatg ggccgcaaag tcattctacc
      541 ccaatgttgg ctgtaatcgg ttcaaaggat taccaatttt cattgtcacc aaaacaatca
      601 aagacaaaaa aattaaccct gtgttttata attctttggc tcatcctttc acaaatttat
      661 attttcctca atattatgtc atggctctta caaattgatc ttcaaatgga cttttcctca
      721 catttaaata agtttgtcaa accacatttt tggtatcgtg aagaaataga aatgccaaag
      781 acatcaacgc aacttctgct ggattttttc aagagcttat ggtcttgagc aataaattgt
      841 ttaccaactg tttttatata ttttatagta attgaattag agaattaaat ataatgcata
      901 ttgattatat ttttgttaag aactggatat aaatgaactt aattttgaat ctctta