PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_059367220             562 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088945), mRNA.
ACCESSION   XM_059367220
VERSION     XM_059367220.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..562
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..562
                     /gene="LOC106088945"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106088945"
     CDS             1..489
                     /gene="LOC106088945"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_059223203.1"
                     /db_xref="GeneID:106088945"
                     /translation="MTTSKILIGVCFIIFAGIFDFAKAVPQWRRGLNGYEYLIEIEQK
                     YNWFEASHLCASQNLHLVEIDSEKKNTDLIHVLKIYPGSSRNLWLGANDEFNQAKDKK
                     RAFYWSSGKKMVFNFWSIENPNNAASNEHCAHIWHSKANFEWNDNVCTNKMGYICEKE
                     IQ"
     polyA_site      562
                     /gene="LOC106088945"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgactacat ctaaaatatt aattggagtt tgttttatta tttttgctgg tatcttcgat
       61 ttcgcgaagg cagtaccaca atggcgcagg ggattaaatg gctacgaata tttaatcgaa
      121 attgaacaaa agtacaactg gtttgaagca tcacacctct gtgcaagtca aaatttgcat
      181 ttggtggaaa ttgactcgga gaaaaagaat acggatttga tccatgtgct gaaaatatat
      241 ccaggatctt cgcgtaattt atggttgggt gccaatgatg aattcaatca ggccaaagat
      301 aagaaacgtg ccttctactg gtcgtcggga aagaaaatgg ttttcaactt ctggtccatt
      361 gaaaatccca ataatgctgc cagcaatgaa cattgcgcac atatttggca ttccaaagcc
      421 aattttgagt ggaatgataa tgtttgtaca aataaaatgg gctacatatg cgaaaaagaa
      481 atccaatagt ccaatttctt ggtgtgattc atttttcaat aaaatcagtc taattaaaaa
      541 tccagtacat taaaagccga aa