Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367219 651 bp mRNA linear INV 02-SEP-2023 (LOC106083241), mRNA. ACCESSION XM_059367219 VERSION XM_059367219.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 32% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..651 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..651 /gene="LOC106083241" /note="uncharacterized LOC106083241; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106083241" CDS 1..651 /gene="LOC106083241" /codon_start=1 /product="uncharacterized protein LOC106083241" /protein_id="XP_059223202.1" /db_xref="GeneID:106083241" /translation="MVNPLQGRHSAEASISAHDAKRLGPRPVVKVWVHIGSSSSSSSS SSSCALRASHLKFALVVACALLGCTVADVSHLGGSYLPPSKPQQTYLPPVQPQQTYLP PAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPVQPQQTY LPPAQPQQTYLPPSEPQQSYLPPSQPQNTYLPPSDNAGQDGGYRYRFVKRYRLRSF" ORIGIN 1 atggtaaatc ctttgcaagg ccgccatagc gcagaggcta gcatttccgc tcatgatgct 61 aaacgcctgg gtccgcgtcc agtggttaag gtatgggttc acattggttc ttcatcatca 121 tcatcatcat cgtcatcttc atgtgctttg cgtgcttcac acttgaaatt cgctttggtg 181 gtggcttgtg ccctattggg ttgcactgta gctgatgtct cccatttggg aggttcttac 241 ttgcctccct ctaagcctca gcaaacctac ctgcctcccg ttcaacccca acagacctac 301 ttgccccctg cccagcctca gcaaacctac ttgccacctg ctcaacctca acagacctac 361 ttgccccctg cccagcctca acaaacttac ctgccacctg ctcaacctca acagacctac 421 ttgccccctg cccagcctca acagacctac ttgccccctg tccagcctca acagacctac 481 ttgccccctg cccaacccca acagacctac ttgcccccct ctgaacctca gcaaagctat 541 ttgcctccct cccaacccca aaacacctac ttgccccctt ccgacaacgc tggtcaagat 601 ggtggctatc gttatcgttt tgtcaagcgt taccgcctca gatctttcta a