PREDICTED: Stomoxys calcitrans uncharacterized LOC106083241

LOCUS       XM_059367219             651 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083241), mRNA.
ACCESSION   XM_059367219
VERSION     XM_059367219.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 32% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..651
                     /gene="LOC106083241"
                     /note="uncharacterized LOC106083241; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106083241"
     CDS             1..651
                     /gene="LOC106083241"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083241"
                     /protein_id="XP_059223202.1"
                     /db_xref="GeneID:106083241"
                     /translation="MVNPLQGRHSAEASISAHDAKRLGPRPVVKVWVHIGSSSSSSSS
                     SSSCALRASHLKFALVVACALLGCTVADVSHLGGSYLPPSKPQQTYLPPVQPQQTYLP
                     PAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPAQPQQTYLPPVQPQQTY
                     LPPAQPQQTYLPPSEPQQSYLPPSQPQNTYLPPSDNAGQDGGYRYRFVKRYRLRSF"
ORIGIN      
        1 atggtaaatc ctttgcaagg ccgccatagc gcagaggcta gcatttccgc tcatgatgct
       61 aaacgcctgg gtccgcgtcc agtggttaag gtatgggttc acattggttc ttcatcatca
      121 tcatcatcat cgtcatcttc atgtgctttg cgtgcttcac acttgaaatt cgctttggtg
      181 gtggcttgtg ccctattggg ttgcactgta gctgatgtct cccatttggg aggttcttac
      241 ttgcctccct ctaagcctca gcaaacctac ctgcctcccg ttcaacccca acagacctac
      301 ttgccccctg cccagcctca gcaaacctac ttgccacctg ctcaacctca acagacctac
      361 ttgccccctg cccagcctca acaaacttac ctgccacctg ctcaacctca acagacctac
      421 ttgccccctg cccagcctca acagacctac ttgccccctg tccagcctca acagacctac
      481 ttgccccctg cccaacccca acagacctac ttgcccccct ctgaacctca gcaaagctat
      541 ttgcctccct cccaacccca aaacacctac ttgccccctt ccgacaacgc tggtcaagat
      601 ggtggctatc gttatcgttt tgtcaagcgt taccgcctca gatctttcta a