Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996993


LOCUS       XM_059367217             942 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996993), mRNA.
ACCESSION   XM_059367217
VERSION     XM_059367217.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..942
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..942
                     /gene="LOC131996993"
                     /note="uncharacterized LOC131996993; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996993"
     CDS             28..942
                     /gene="LOC131996993"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996993"
                     /protein_id="XP_059223200.1"
                     /db_xref="GeneID:131996993"
                     /translation="MENSSFTKSGIPKCRICKDRHFLKNCPTFQRMTVSERRDVIREK
                     GFCFNCLCTAHKRNWCPSRNKCMVCRLNHHTMVHMDKLDSPKTSHQHRLKSSKKSPDP
                     TERYGSGSRSQNYKERNQTQRRAQSKPSSTFGRPRTHFKERLSNKARAHIFLPTALAR
                     VQTSTDPEKARLLLNSGEAQTVILKTLVDRLHLRTTRRDNKEYCTLNLESYYDAQAKI
                     QIVGLVQKSFRTTLPSITDTPKLQSIYNHLTNLADPHFYKPSNVEIILANDNIPKILR
                     AGMIQTSSNMPIAQSTIFGWTISGDCQY"
ORIGIN      
        1 cctttcgcat attctaaaaa gactactatg gaaaacagct catttaccaa atctggcatc
       61 ccaaaatgtc gcatctgtaa agaccgacat ttcttaaaaa actgcccaac tttccaaaga
      121 atgaccgtat cagaacgcag agatgtcata cgtgaaaagg gtttttgttt taactgtcta
      181 tgtacagcac acaaacgcaa ctggtgcccg tccagaaata aatgtatggt ctgtcggcta
      241 aaccaccata ccatggttca tatggacaaa cttgattccc ctaaaacatc acatcaacac
      301 cgtttaaaat catctaaaaa atctccagac ccaactgaac gatatggttc aggctcccgt
      361 tcgcagaatt ataaggagag aaaccaaacg cagcgacgcg cacaatctaa acccagctct
      421 acgttcggtc gacctcgaac gcattttaag gaacggctga gcaacaaagc tcgagcccac
      481 atatttttac caacggctct tgcccgggtc cagacctcaa ccgatccaga aaaggcgagg
      541 ctactactga attctggaga ggcacagacg gtgatattaa agactttagt ggatcgatta
      601 cacctgcgca ctacgcgcag agacaataag gaatattgta cgttaaatct cgagtcttac
      661 tatgacgctc aagccaaaat tcaaatagtt ggtttagtac aaaagagttt tcgtacaact
      721 ctaccatcga taaccgatac gccaaaacta caaagtatct ataaccacct caccaatcta
      781 gctgaccctc acttctacaa gccttccaat gtggaaatca tattggccaa cgacaatata
      841 cctaagattc tgcgagcagg aatgatccaa acctcctcta acatgcccat tgcgcagagt
      901 acaatttttg gctggactat ctctggagat tgtcaatatt ga