Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367217 942 bp mRNA linear INV 02-SEP-2023 (LOC131996993), mRNA. ACCESSION XM_059367217 VERSION XM_059367217.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..942 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..942 /gene="LOC131996993" /note="uncharacterized LOC131996993; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996993" CDS 28..942 /gene="LOC131996993" /codon_start=1 /product="uncharacterized protein LOC131996993" /protein_id="XP_059223200.1" /db_xref="GeneID:131996993" /translation="MENSSFTKSGIPKCRICKDRHFLKNCPTFQRMTVSERRDVIREK GFCFNCLCTAHKRNWCPSRNKCMVCRLNHHTMVHMDKLDSPKTSHQHRLKSSKKSPDP TERYGSGSRSQNYKERNQTQRRAQSKPSSTFGRPRTHFKERLSNKARAHIFLPTALAR VQTSTDPEKARLLLNSGEAQTVILKTLVDRLHLRTTRRDNKEYCTLNLESYYDAQAKI QIVGLVQKSFRTTLPSITDTPKLQSIYNHLTNLADPHFYKPSNVEIILANDNIPKILR AGMIQTSSNMPIAQSTIFGWTISGDCQY" ORIGIN 1 cctttcgcat attctaaaaa gactactatg gaaaacagct catttaccaa atctggcatc 61 ccaaaatgtc gcatctgtaa agaccgacat ttcttaaaaa actgcccaac tttccaaaga 121 atgaccgtat cagaacgcag agatgtcata cgtgaaaagg gtttttgttt taactgtcta 181 tgtacagcac acaaacgcaa ctggtgcccg tccagaaata aatgtatggt ctgtcggcta 241 aaccaccata ccatggttca tatggacaaa cttgattccc ctaaaacatc acatcaacac 301 cgtttaaaat catctaaaaa atctccagac ccaactgaac gatatggttc aggctcccgt 361 tcgcagaatt ataaggagag aaaccaaacg cagcgacgcg cacaatctaa acccagctct 421 acgttcggtc gacctcgaac gcattttaag gaacggctga gcaacaaagc tcgagcccac 481 atatttttac caacggctct tgcccgggtc cagacctcaa ccgatccaga aaaggcgagg 541 ctactactga attctggaga ggcacagacg gtgatattaa agactttagt ggatcgatta 601 cacctgcgca ctacgcgcag agacaataag gaatattgta cgttaaatct cgagtcttac 661 tatgacgctc aagccaaaat tcaaatagtt ggtttagtac aaaagagttt tcgtacaact 721 ctaccatcga taaccgatac gccaaaacta caaagtatct ataaccacct caccaatcta 781 gctgaccctc acttctacaa gccttccaat gtggaaatca tattggccaa cgacaatata 841 cctaagattc tgcgagcagg aatgatccaa acctcctcta acatgcccat tgcgcagagt 901 acaatttttg gctggactat ctctggagat tgtcaatatt ga