PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_059367215             471 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996992), mRNA.
ACCESSION   XM_059367215
VERSION     XM_059367215.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 12% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..471
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..471
                     /gene="LOC131996992"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 21
                     Proteins"
                     /db_xref="GeneID:131996992"
     CDS             1..471
                     /gene="LOC131996992"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_059223198.1"
                     /db_xref="GeneID:131996992"
                     /translation="MAVLNQNVFKFLFVLQLIIQGVQPLGKIHHVNKHGLGKVYIETA
                     HKCNWFKAQIECTRKNMSLIAVDTAAKAAALDEILTKEFDTSCPHLWIGASDLAVEGT
                     FQWLKTGQPMSYSKWKPNMPDNYLGKEHCVHITHDRDWNDIKCGFKYGYICEGA"
ORIGIN      
        1 atggcggttc taaatcagaa cgttttcaaa tttctattcg ttttgcaact tatcatacaa
       61 ggagtacagc ctttgggaaa gatacaccat gtgaacaaac atggcctagg caaggtctac
      121 atagaaactg cccataagtg caattggttt aaagcccaga tagaatgtac ccgtaaaaat
      181 atgtccctca ttgctgtgga tacagcggca aaagctgccg cactggatga gatattgaca
      241 aaggaatttg atacctcttg ccctcatcta tggattggtg ctagtgattt agctgttgaa
      301 ggaacttttc agtggctaaa aaccggccag ccaatgtcct attcgaagtg gaagccaaat
      361 atgccagaca attacctggg caaggagcat tgtgttcata tcacccatga tcgtgattgg
      421 aatgatatta aatgtggttt taaatatggc tatatatgtg aaggagcata a