PREDICTED: Stomoxys calcitrans thioredoxin, mitochondrial-like

LOCUS       XM_059367202             522 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996985), mRNA.
ACCESSION   XM_059367202
VERSION     XM_059367202.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..522
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..522
                     /gene="LOC131996985"
                     /note="thioredoxin, mitochondrial-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:131996985"
     CDS             1..522
                     /gene="LOC131996985"
                     /codon_start=1
                     /product="thioredoxin, mitochondrial-like"
                     /protein_id="XP_059223185.1"
                     /db_xref="GeneID:131996985"
                     /translation="MLKIAAEGLMPCLKACVQAPWHCHNMCRRRMPNVFTATRKCLSQ
                     SQVTLKQFSIENSKEFDQKVMQNEHPVVVDFHAEWCDPCTKLTPKISAMLINSDEVDL
                     AIIDVEKNTDLVDTFDIHSVPTVFAVQNGKIVYKFIGLVEANILKSMIDNLKSTKSKT
                     ADTASNSSDEGTA"
ORIGIN      
        1 atgcttaaaa tagcagctga aggattaatg ccttgcctga aagcctgtgt tcaggcccct
       61 tggcattgtc acaatatgtg tagaagaagg atgccaaatg tcttcacagc tacacggaaa
      121 tgtttatctc aaagtcaggt gacactgaag caattttcaa ttgaaaattc caaggaattt
      181 gatcagaagg taatgcaaaa tgaacatcct gttgttgttg attttcatgc cgaatggtgt
      241 gatccttgca caaaactaac tccaaaaata tccgcgatgc taatcaattc agatgaagta
      301 gatctggcca ttatagatgt ggagaaaaat accgatctgg tggacacatt tgatattcat
      361 tctgtgccca ctgtatttgc cgttcaaaat ggtaaaatag tttataaatt tataggtctc
      421 gtagaggcaa atattcttaa atccatgatt gacaacttga aaagtacaaa gtcgaaaacg
      481 gcagacactg caagcaattc atctgatgaa ggcacggcgt aa