Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367198 956 bp mRNA linear INV 02-SEP-2023 domain-containing protein 2-like (LOC106082863), partial mRNA. ACCESSION XM_059367198 VERSION XM_059367198.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..956 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..>956 /gene="LOC106082863" /note="fatty acid hydroxylase domain-containing protein 2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106082863" CDS 57..>956 /gene="LOC106082863" /codon_start=1 /product="fatty acid hydroxylase domain-containing protein 2-like" /protein_id="XP_059223181.1" /db_xref="GeneID:106082863" /translation="MFSLSSAIIMNAGQILGQLAAKYHYVGTRIEGKWNDFLDVIGDD PQTVWVFGTTAVFMLVYWLNASWYTFMDITNRPKFVRKYKIQPGKNEPVEMKKLFEGI LNVLMNQTIVGIPMYFVLYHTLFKVRCSEGPIRELPTLQKILFDIVVVSIMEEFNFYY IHRLMHHKAIYKYVHKKHHEWTAPIAAITFYCHPLEHIFLNLIPVSLSFALVRSHVFT VWLFLTLAILNSMADHAGYSFPRSGASIRYHDYHHSKFNYNYGMFGWLDKLHGTYKET KVELKTTEKSKDKQAKSIGKNLNK" ORIGIN 1 tctaaaaaag gccaaataca cttgcttgaa taaacaaaat cgtacagcga taattgatgt 61 ttagtttaag ttcagcaata atcatgaacg cgggtcaaat tcttggtcaa ttggcagcaa 121 aatatcatta tgtgggaaca cgcatagaag gaaaatggaa tgattttttg gatgttattg 181 gtgatgatcc tcaaactgtg tgggtttttg gtaccactgc agtttttatg ttggtctatt 241 ggctaaacgc tagctggtac acatttatgg atataacaaa tcgtcccaaa tttgttcgca 301 aatataaaat tcaaccagga aaaaatgagc cagttgaaat gaagaaattg ttcgaaggca 361 tattaaatgt gctaatgaat caaacaattg tgggcatacc catgtacttt gtactgtatc 421 acacgctttt taaggtacgc tgtagcgaag ggcccatacg tgaattgcca acattacaaa 481 agattctctt tgacattgtc gtagtttcga ttatggaaga gtttaacttt tactacatac 541 atcgactgat gcatcataag gcgatttata aatatgttca taagaaacat catgaatgga 601 ctgcgcccat agcggccatt acattctact gtcatccttt ggagcatatc tttttaaatc 661 taatacctgt atcgctttca tttgccctgg tgcgatcgca tgtttttacc gtttggctat 721 tcctaacatt ggccattctg aattcaatgg ctgatcatgc gggttactcg tttccacgtt 781 cgggtgcttc gatacgttat catgattacc atcattccaa atttaactac aattacggca 841 tgttcggatg gttggataaa ctgcatggca cttacaagga gaccaaagtt gaacttaaaa 901 caaccgagaa atctaaggac aaacaagcaa aatcaattgg aaaaaatcta aataag