Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fatty acid hydroxylase


LOCUS       XM_059367198             956 bp    mRNA    linear   INV 02-SEP-2023
            domain-containing protein 2-like (LOC106082863), partial mRNA.
ACCESSION   XM_059367198
VERSION     XM_059367198.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..956
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..>956
                     /gene="LOC106082863"
                     /note="fatty acid hydroxylase domain-containing protein
                     2-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:106082863"
     CDS             57..>956
                     /gene="LOC106082863"
                     /codon_start=1
                     /product="fatty acid hydroxylase domain-containing protein
                     2-like"
                     /protein_id="XP_059223181.1"
                     /db_xref="GeneID:106082863"
                     /translation="MFSLSSAIIMNAGQILGQLAAKYHYVGTRIEGKWNDFLDVIGDD
                     PQTVWVFGTTAVFMLVYWLNASWYTFMDITNRPKFVRKYKIQPGKNEPVEMKKLFEGI
                     LNVLMNQTIVGIPMYFVLYHTLFKVRCSEGPIRELPTLQKILFDIVVVSIMEEFNFYY
                     IHRLMHHKAIYKYVHKKHHEWTAPIAAITFYCHPLEHIFLNLIPVSLSFALVRSHVFT
                     VWLFLTLAILNSMADHAGYSFPRSGASIRYHDYHHSKFNYNYGMFGWLDKLHGTYKET
                     KVELKTTEKSKDKQAKSIGKNLNK"
ORIGIN      
        1 tctaaaaaag gccaaataca cttgcttgaa taaacaaaat cgtacagcga taattgatgt
       61 ttagtttaag ttcagcaata atcatgaacg cgggtcaaat tcttggtcaa ttggcagcaa
      121 aatatcatta tgtgggaaca cgcatagaag gaaaatggaa tgattttttg gatgttattg
      181 gtgatgatcc tcaaactgtg tgggtttttg gtaccactgc agtttttatg ttggtctatt
      241 ggctaaacgc tagctggtac acatttatgg atataacaaa tcgtcccaaa tttgttcgca
      301 aatataaaat tcaaccagga aaaaatgagc cagttgaaat gaagaaattg ttcgaaggca
      361 tattaaatgt gctaatgaat caaacaattg tgggcatacc catgtacttt gtactgtatc
      421 acacgctttt taaggtacgc tgtagcgaag ggcccatacg tgaattgcca acattacaaa
      481 agattctctt tgacattgtc gtagtttcga ttatggaaga gtttaacttt tactacatac
      541 atcgactgat gcatcataag gcgatttata aatatgttca taagaaacat catgaatgga
      601 ctgcgcccat agcggccatt acattctact gtcatccttt ggagcatatc tttttaaatc
      661 taatacctgt atcgctttca tttgccctgg tgcgatcgca tgtttttacc gtttggctat
      721 tcctaacatt ggccattctg aattcaatgg ctgatcatgc gggttactcg tttccacgtt
      781 cgggtgcttc gatacgttat catgattacc atcattccaa atttaactac aattacggca
      841 tgttcggatg gttggataaa ctgcatggca cttacaagga gaccaaagtt gaacttaaaa
      901 caaccgagaa atctaaggac aaacaagcaa aatcaattgg aaaaaatcta aataag