PREDICTED: Stomoxys calcitrans gastrula zinc finger protein

LOCUS       XM_059367192             657 bp    mRNA    linear   INV 02-SEP-2023
            XlCGF71.1-like (LOC131996979), mRNA.
ACCESSION   XM_059367192
VERSION     XM_059367192.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..657
                     /gene="LOC131996979"
                     /note="gastrula zinc finger protein XlCGF71.1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 20 Proteins"
                     /db_xref="GeneID:131996979"
     CDS             1..657
                     /gene="LOC131996979"
                     /codon_start=1
                     /product="gastrula zinc finger protein XlCGF71.1-like"
                     /protein_id="XP_059223175.1"
                     /db_xref="GeneID:131996979"
                     /translation="MYSIEQLFKKSIRLVCSKQLSNASSYKYHMQLHSENTPFKCDVC
                     GECFKTRNAFVGHRLTHDPDNPNTCDICGKSYRQAPSLRIHMLSHTGEKPFKCEICGK
                     CLTQKSGYKKHMLTHTGEKPYSCDICGKLFRISSNMLAHRRTHSSDKPYECLKCAKSF
                     GTSELLRRHVAVHSEEKFKCDTCGKEFKRQLSLQAHIESHRDEVNSQKVVKSSVSQFV
                     "
ORIGIN      
        1 atgtacagca tcgaacagct gtttaagaaa tccataagat tagtttgtag caaacagctg
       61 agtaatgcca gctcatacaa atatcacatg caactacatt cagagaacac ccccttcaaa
      121 tgtgacgttt gcggcgaatg ttttaaaacg cgtaacgctt ttgtgggtca tcgattaact
      181 catgatcccg acaatcctaa tacctgtgat atatgtggga aatcgtatcg tcaagcccca
      241 tcattaagaa ttcacatgct ctctcatact ggagaaaaac cctttaaatg tgaaatctgt
      301 ggaaaatgtc ttactcaaaa atcgggctac aagaagcata tgctaacaca tactggtgag
      361 aagccatact cctgtgacat ttgtggcaaa ttgttccgta tctcaagcaa tatgttggcc
      421 catcgcagaa cccactccag cgataaaccc tatgaatgct tgaagtgtgc aaaatcgttt
      481 ggcacttccg aactactcag acgacatgtg gccgtacatt ccgaggagaa atttaagtgt
      541 gatacatgtg gtaaagaatt caaaaggcaa ttgtcactac aagcccatat tgaaagtcat
      601 cgcgatgagg ttaattctca aaaagttgtg aaatcaagcg tttcacaatt tgtgtaa