Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996974


LOCUS       XM_059367186             927 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996974), mRNA.
ACCESSION   XM_059367186
VERSION     XM_059367186.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..927
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..927
                     /gene="LOC131996974"
                     /note="uncharacterized LOC131996974; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:131996974"
     CDS             1..927
                     /gene="LOC131996974"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996974"
                     /protein_id="XP_059223169.1"
                     /db_xref="GeneID:131996974"
                     /translation="MAPLPQDRCTITPAFHVTGIDFAGPFDIKSSPLRRSPLLKGYVS
                     IFVCFATKAVHLEPCSELSTAAFEAAFARFLGRRGLPRKVVSDNGRNFVGASRKLLRE
                     FRSFIQVVASDISEKYSTQGFEWQFIPPHAPHMGGLWEAAVKSFKHHFKRVAGAHLFT
                     FEQFATVLARIEGVLNSRPISAVSEDPNDLTALTPGHFLKGSPIMSFPEPNAQDISLI
                     NRWLRLKAIHHQFATQWKEDYLKALHKRYKWKNTSPNVKIGDLVVVIDDLLPPSDWRL
                     GRVVKTHAGSDSNTRVAEIKHAWSRYVQMPSM"
ORIGIN      
        1 atggcaccgc tccctcaaga tagatgtacg ataactccgg catttcacgt cacgggcata
       61 gactttgcag ggccttttga cattaagagt tcgccactac gccgttcccc tctcttaaag
      121 ggttatgtca gcatctttgt atgcttcgcc acgaaagccg tacatctgga accatgctcg
      181 gaactttcca cggcggcatt tgaggccgct tttgctcgtt ttcttgggag acgaggccta
      241 cctcggaagg tagtttcgga taatggtagg aatttcgttg gtgccagtcg caagcttcta
      301 cgggaattca ggagttttat ccaagtagta gcaagcgata tatctgagaa atactcgaca
      361 caggggtttg aatggcaatt tataccgccc catgctccac atatgggtgg actttgggag
      421 gcagccgtta agagcttcaa acaccacttt aaacgagtgg ctggagctca cttgttcacc
      481 ttcgaacagt ttgctaccgt tcttgcgcgg atcgaaggag tcttgaactc acgtccaatt
      541 tccgccgtct ctgaggaccc gaacgacctc acagctttga ctcccgggca ctttttgaag
      601 ggttcgccaa tcatgtcatt tccggagccg aatgcgcaag acatatccct gataaataga
      661 tggctaaggc tgaaggcgat acatcaccag ttcgctacac aatggaagga agattacctc
      721 aaggctcttc ataaacgata taagtggaag aacacttctc ctaatgtaaa gatcggtgat
      781 cttgtagtcg taattgacga tttgctgccc cctagcgact ggcgattggg gagagtagtt
      841 aagactcacg ctgggtccga tagcaataca agagttgcgg agataaaaca tgcctggtca
      901 agatatgtac aaatgccatc tatgtaa