Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367186 927 bp mRNA linear INV 02-SEP-2023 (LOC131996974), mRNA. ACCESSION XM_059367186 VERSION XM_059367186.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..927 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..927 /gene="LOC131996974" /note="uncharacterized LOC131996974; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:131996974" CDS 1..927 /gene="LOC131996974" /codon_start=1 /product="uncharacterized protein LOC131996974" /protein_id="XP_059223169.1" /db_xref="GeneID:131996974" /translation="MAPLPQDRCTITPAFHVTGIDFAGPFDIKSSPLRRSPLLKGYVS IFVCFATKAVHLEPCSELSTAAFEAAFARFLGRRGLPRKVVSDNGRNFVGASRKLLRE FRSFIQVVASDISEKYSTQGFEWQFIPPHAPHMGGLWEAAVKSFKHHFKRVAGAHLFT FEQFATVLARIEGVLNSRPISAVSEDPNDLTALTPGHFLKGSPIMSFPEPNAQDISLI NRWLRLKAIHHQFATQWKEDYLKALHKRYKWKNTSPNVKIGDLVVVIDDLLPPSDWRL GRVVKTHAGSDSNTRVAEIKHAWSRYVQMPSM" ORIGIN 1 atggcaccgc tccctcaaga tagatgtacg ataactccgg catttcacgt cacgggcata 61 gactttgcag ggccttttga cattaagagt tcgccactac gccgttcccc tctcttaaag 121 ggttatgtca gcatctttgt atgcttcgcc acgaaagccg tacatctgga accatgctcg 181 gaactttcca cggcggcatt tgaggccgct tttgctcgtt ttcttgggag acgaggccta 241 cctcggaagg tagtttcgga taatggtagg aatttcgttg gtgccagtcg caagcttcta 301 cgggaattca ggagttttat ccaagtagta gcaagcgata tatctgagaa atactcgaca 361 caggggtttg aatggcaatt tataccgccc catgctccac atatgggtgg actttgggag 421 gcagccgtta agagcttcaa acaccacttt aaacgagtgg ctggagctca cttgttcacc 481 ttcgaacagt ttgctaccgt tcttgcgcgg atcgaaggag tcttgaactc acgtccaatt 541 tccgccgtct ctgaggaccc gaacgacctc acagctttga ctcccgggca ctttttgaag 601 ggttcgccaa tcatgtcatt tccggagccg aatgcgcaag acatatccct gataaataga 661 tggctaaggc tgaaggcgat acatcaccag ttcgctacac aatggaagga agattacctc 721 aaggctcttc ataaacgata taagtggaag aacacttctc ctaatgtaaa gatcggtgat 781 cttgtagtcg taattgacga tttgctgccc cctagcgact ggcgattggg gagagtagtt 841 aagactcacg ctgggtccga tagcaataca agagttgcgg agataaaaca tgcctggtca 901 agatatgtac aaatgccatc tatgtaa