PREDICTED: Stomoxys calcitrans uncharacterized LOC131996966

LOCUS       XM_059367176             554 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996966), mRNA.
ACCESSION   XM_059367176
VERSION     XM_059367176.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 29% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..554
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..554
                     /gene="LOC131996966"
                     /note="uncharacterized LOC131996966; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996966"
     CDS             1..507
                     /gene="LOC131996966"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996966"
                     /protein_id="XP_059223159.1"
                     /db_xref="GeneID:131996966"
                     /translation="MNFLWMRVSGKATMRYCSSPKNGRGGEKPPTNIVYCSCFRCRMR
                     EVFPVVALSCSCIVFGIANYKPKATYTGSKERRVWNAQHSAVLEISSTILGRNCQIEV
                     RKFYQRIKHQTDGFGAGTSSCRDKEGNLVSDTDKMLRICKEHFTQLLVSDDGGKEDTA
                     EPIPDDGI"
ORIGIN      
        1 atgaactttc tttggatgcg tgttagtggt aaagcaacaa tgcgctattg ctcctcacca
       61 aagaatggta ggggcggtga aaaaccacca acaaatattg tttattgtag ttgttttcgt
      121 tgtcgtatgc gcgaagtttt tcctgttgtt gctttatcct gcagttgtat cgtatttgga
      181 attgcgaatt acaaaccaaa agctacatac acagggagca aggaacgaag agtgtggaac
      241 gctcaacact ccgctgttct agaaatctct tcaacaattt tgggacgaaa ttgccagatt
      301 gaagtccgga aattctacca aagaattaaa catcaaactg acggctttgg agcaggcaca
      361 tcctcctgca gagacaaaga aggaaatctg gtgtctgaca cagataaaat gctgaggata
      421 tgtaaagaac attttaccca actgctagtg tccgacgatg gcggcaaaga ggacaccgca
      481 gaaccaatcc ctgatgatgg tatataatgt ttacctccca gtcagaatga ggtccaagta
      541 gcagtgaccc gact