PREDICTED: Stomoxys calcitrans uncharacterized LOC131996963

LOCUS       XM_059367173             819 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996963), mRNA.
ACCESSION   XM_059367173
VERSION     XM_059367173.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..819
                     /gene="LOC131996963"
                     /note="uncharacterized LOC131996963; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:131996963"
     CDS             1..819
                     /gene="LOC131996963"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996963"
                     /protein_id="XP_059223156.1"
                     /db_xref="GeneID:131996963"
                     /translation="MAAVEAIVAEEVEAMEAAVGAMEEAVEVVTRKPTNAGASAYASG
                     GGGGHGGGYGAGGGHGGGYGAGGGGGGGYGGGGGVHVQTYKIITSGGGGGYGGGGGHG
                     GGGGGGYGGGAGGGGYGGGHVQTYKIITSGGGGGYGGGGYSGGAAASAGGGYIGGGGY
                     GGGGGGGGGGGHVQTYKIISSGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGVGA
                     AVAAASAVAGSSAGGGGGGWSTGGGCVAVLTVNDIVAASALLHMTKSYRAALMA"
ORIGIN      
        1 atggcggcgg tggaggctat agtggcggag gaggtggagg ctatggaggc ggcggtgggg
       61 gctatggagg aggcggtgga ggtggtcacg cgcaaaccta ccaatgcggg agcgtcagct
      121 tatgctagcg gcggaggcgg tggccacggt ggtggatatg gtgctggcgg cggtcacggt
      181 ggtggatatg gtgctggcgg tggtggtggt ggcggatatg gtggtggcgg cggtgtccac
      241 gttcaaacgt ataaaatcat tacttccgga ggtggtggcg gttatggtgg tggcggcggt
      301 catggcggtg gtggtggcgg cggttatggc ggtggtgctg gcggaggcgg ttatggaggt
      361 ggacatgttc aaacctataa aatcattaca tccggaggcg gtggcggcta cggtggtggc
      421 ggctacagtg gtggcgcagc tgctagcgct ggaggaggct atattggtgg tggcgggtat
      481 ggtggaggag gcggcggcgg tggtggtggt ggtcacgtcc aaacctataa aatcatttct
      541 tcgggcggag gtggtggcgg ttatggcggc ggaggaggtg gtggttatgg cggcggaggt
      601 ggtggtggct atggcggcgg aggaggcggt ggctatggcg gcggtgtcgg tgccgctgtt
      661 gctgctgcta gtgctgttgc tggatccagt gctggaggcg gcggtggagg ttggtccacc
      721 ggtggcggtt gtgttgctgt cttaacagtc aatgacattg tggctgcttc ggcattgctg
      781 catatgacaa agagttatcg tgcagccctc atggcatga