PREDICTED: Stomoxys calcitrans uncharacterized transmembrane

LOCUS       XM_059367172             447 bp    mRNA    linear   INV 02-SEP-2023
            protein DDB_G0289901-like (LOC106090241), mRNA.
ACCESSION   XM_059367172
VERSION     XM_059367172.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..447
                     /gene="LOC106090241"
                     /note="uncharacterized transmembrane protein
                     DDB_G0289901-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106090241"
     CDS             1..447
                     /gene="LOC106090241"
                     /codon_start=1
                     /product="uncharacterized transmembrane protein
                     DDB_G0289901-like"
                     /protein_id="XP_059223155.1"
                     /db_xref="GeneID:106090241"
                     /translation="MKVFLCLWALTTVANAGLLYGGSSGFAAGVSTDSDVSFNDESGR
                     TAGSLSSGGPTTTIRAISDVGEGSTTGGWSNGGDSSDSRCHEGGCSSGDAESVISDAE
                     DKSSAGSAGGWPAVGGVSSAEAVKIIKIISQYEASGGNIGVHNGWR"
ORIGIN      
        1 atgaaggttt tcttgtgtct ttgggctcta actactgtag caaatgccgg tttattatat
       61 ggcggcagta gtggatttgc tgctggtgta agtacagatt ccgatgtctc gtttaatgat
      121 gaaagtggta gaactgctgg aagtttgtcc agcggaggtc ctaccaccac aattcgagct
      181 atttccgatg ttggagaagg tagtaccact ggtggctggt ccaatggagg tgattcctct
      241 gacagccgat gccatgaagg tggttgtagc agtggagatg ctgagtcagt tatttctgac
      301 gcagaagata aaagttcagc tggcagcgct ggtggttggc cagctgttgg tggtgtttcc
      361 tctgccgaag cagttaaaat tatcaaaatt atatctcaat atgaggcctc aggtggaaac
      421 atcggcgttc ataatggctg gcgatga