Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367171 849 bp mRNA linear INV 02-SEP-2023 (LOC106090242), mRNA. ACCESSION XM_059367171 VERSION XM_059367171.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 49% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..849 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..849 /gene="LOC106090242" /note="uncharacterized LOC106090242; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090242" CDS 1..849 /gene="LOC106090242" /codon_start=1 /product="uncharacterized protein LOC106090242" /protein_id="XP_059223154.1" /db_xref="GeneID:106090242" /translation="MKVFLCLLAICAMTNAGFMFGGGRRRGGGRHGGGRHGGVRHGGV RHGGGRHVGGGHFGGGHFGGGHFGGGFHGGYGAGGGGHGGGGPSGGHGGGHGGGHRVG HGGGHGGGHEGGHAGGHGGGHGGGHEGGHGGGHGGGHGGGHGGGHGGGHEGGHGGGHE GGHGGGHGGGHGGEHGGEHGGGHGGEHGGGHEVGHEGGEYGVYGGGHERGEYGGDGAV EVVSGDGTIIIPEGGFGVVDGGGQIYKIITQGGGGGGYGGNAVGWSPMAPVVGNLRTF VIPPVF" ORIGIN 1 atgaaggttt tcctatgttt attggcgatc tgcgccatga ctaatgcggg atttatgttc 61 ggtggagggc gtcgtcgcgg tggcgggcgt cacggtggtg gccggcacgg cggcgtccgc 121 cacggtggtg tcaggcacgg gggcggtcgt cacgttggcg gtggtcactt tggcggcggt 181 cactttggcg gcggtcactt tggaggcggc tttcacggtg gttatggagc tggtggtggt 241 ggtcatggcg gcggtggtcc tagtggaggt cacggaggtg gtcatggagg tggtcacaga 301 gtgggtcatg gtggtggtca cggaggtgga cacgaaggtg gacacgcagg tggacacgga 361 ggtggtcacg gaggtggaca cgaaggtgga catggaggtg gacatggagg tggacacgga 421 ggtggacatg gaggtggaca cggaggtgga cacgaaggtg gacacggagg tggacacgaa 481 ggtggacatg gaggtggaca cggaggtgga cacggaggcg aacacggagg agaacacgga 541 ggtggtcacg gaggagaaca cggaggtgga catgaagttg gtcatgaagg cggcgaatat 601 ggtgtttacg gaggtggtca cgaacgcggc gaatatggag gtgatggtgc cgttgaagtt 661 gttagtggcg atggtacaat cattattcct gaaggaggtt tcggcgttgt tgatggcggt 721 ggccaaatct acaagattat cacacaagga ggcggtggtg gaggttatgg cggtaatgct 781 gttggctggt cccccatggc tccggtggtt ggtaatttac gcacatttgt gattcctcct 841 gtgttttag