Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090242


LOCUS       XM_059367171             849 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090242), mRNA.
ACCESSION   XM_059367171
VERSION     XM_059367171.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 49% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..849
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..849
                     /gene="LOC106090242"
                     /note="uncharacterized LOC106090242; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106090242"
     CDS             1..849
                     /gene="LOC106090242"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090242"
                     /protein_id="XP_059223154.1"
                     /db_xref="GeneID:106090242"
                     /translation="MKVFLCLLAICAMTNAGFMFGGGRRRGGGRHGGGRHGGVRHGGV
                     RHGGGRHVGGGHFGGGHFGGGHFGGGFHGGYGAGGGGHGGGGPSGGHGGGHGGGHRVG
                     HGGGHGGGHEGGHAGGHGGGHGGGHEGGHGGGHGGGHGGGHGGGHGGGHEGGHGGGHE
                     GGHGGGHGGGHGGEHGGEHGGGHGGEHGGGHEVGHEGGEYGVYGGGHERGEYGGDGAV
                     EVVSGDGTIIIPEGGFGVVDGGGQIYKIITQGGGGGGYGGNAVGWSPMAPVVGNLRTF
                     VIPPVF"
ORIGIN      
        1 atgaaggttt tcctatgttt attggcgatc tgcgccatga ctaatgcggg atttatgttc
       61 ggtggagggc gtcgtcgcgg tggcgggcgt cacggtggtg gccggcacgg cggcgtccgc
      121 cacggtggtg tcaggcacgg gggcggtcgt cacgttggcg gtggtcactt tggcggcggt
      181 cactttggcg gcggtcactt tggaggcggc tttcacggtg gttatggagc tggtggtggt
      241 ggtcatggcg gcggtggtcc tagtggaggt cacggaggtg gtcatggagg tggtcacaga
      301 gtgggtcatg gtggtggtca cggaggtgga cacgaaggtg gacacgcagg tggacacgga
      361 ggtggtcacg gaggtggaca cgaaggtgga catggaggtg gacatggagg tggacacgga
      421 ggtggacatg gaggtggaca cggaggtgga cacgaaggtg gacacggagg tggacacgaa
      481 ggtggacatg gaggtggaca cggaggtgga cacggaggcg aacacggagg agaacacgga
      541 ggtggtcacg gaggagaaca cggaggtgga catgaagttg gtcatgaagg cggcgaatat
      601 ggtgtttacg gaggtggtca cgaacgcggc gaatatggag gtgatggtgc cgttgaagtt
      661 gttagtggcg atggtacaat cattattcct gaaggaggtt tcggcgttgt tgatggcggt
      721 ggccaaatct acaagattat cacacaagga ggcggtggtg gaggttatgg cggtaatgct
      781 gttggctggt cccccatggc tccggtggtt ggtaatttac gcacatttgt gattcctcct
      841 gtgttttag