PREDICTED: Stomoxys calcitrans keratin-associated protein 6-2-like

LOCUS       XM_059367165             684 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093588), mRNA.
ACCESSION   XM_059367165
VERSION     XM_059367165.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..684
                     /gene="LOC106093588"
                     /note="keratin-associated protein 6-2-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106093588"
     CDS             1..684
                     /gene="LOC106093588"
                     /codon_start=1
                     /product="keratin-associated protein 6-2-like"
                     /protein_id="XP_059223148.1"
                     /db_xref="GeneID:106093588"
                     /translation="MKAFLFAIGLVALLNPTQATFEKLGLVVGGGVGAVGYNNNYGSG
                     YSGYRSGRSYSGSYGYGGGNGAGYGGSYSPGYTNNVKVIKVTVAPSTGPYGGYGGGSY
                     GAGYGGSYGVAPVAAITTPIITAVTTPVVTSGINSYGSSGYGGYGAGSYFGGAYESGH
                     YGGGYGASIPATFGYGPGYGYGGGFGLGFGPTVILMSESEKQTRISEKYIKVAFAQDM
                     IAENQEIKL"
ORIGIN      
        1 atgaaggcct tcctgtttgc cattggtttg gtggctctgc ttaatccaac tcaggcaact
       61 tttgaaaagt tgggtctagt tgtcggtggt ggcgtaggag cagttggcta taataacaac
      121 tatggttctg gttatagcgg ttaccgaagc ggcaggtcat atagtggtag ttacggttat
      181 ggaggtggca acggtgcagg ttatggtggc agttatagcc ctggatatac aaataatgtt
      241 aaagtgataa aagttactgt agcacctagc actggcccat acgggggcta tggcggtgga
      301 tcctatggtg caggatatgg cggcagctat ggcgttgcac ctgtggctgc tattacaaca
      361 ccaataataa ctgcagtcac tacacccgtt gttacatcgg gcattaattc ctatggcagc
      421 agtggttatg gtggctatgg ggctggttct tactttggag gagcatatga aagtggccac
      481 tatggcggtg gatatggggc cagtattcca gccacatttg gttatggtcc aggttatggc
      541 tatggaggcg gctttggttt gggttttgga cccactgtga ttttaatgtc cgaatcggag
      601 aaacaaacca gaatatcgga gaaatatata aaagtagctt ttgctcagga tatgattgca
      661 gaaaatcaag agataaaact gtaa