PREDICTED: Stomoxys calcitrans uncharacterized LOC131996958

LOCUS       XM_059367164             558 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996958), mRNA.
ACCESSION   XM_059367164
VERSION     XM_059367164.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..558
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..558
                     /gene="LOC131996958"
                     /note="uncharacterized LOC131996958; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:131996958"
     CDS             1..558
                     /gene="LOC131996958"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996958"
                     /protein_id="XP_059223147.1"
                     /db_xref="GeneID:131996958"
                     /translation="MFRVKTYEDQACLRSSSAGKRPFEVVVHNVTCSTFDSLAPLVLC
                     DVNKLATSRYSINIWFKLSRTVPAHIIVRGIIDVGGFGRKTVRFFDIKINVCDLLHWS
                     SSSVFLVRQVMDIIRRNGNLPLSCPIEADKMYNLTNLVITDELFPMYTPAIHLNVTVN
                     FYDKEKLLVTYLLRGYTIPRNKRKF"
ORIGIN      
        1 atgtttcgcg tcaaaacata cgaagatcaa gcctgcttgc gcagcagttc agccggcaag
       61 cgaccctttg aagtggtagt ccataatgtc acttgttcaa cctttgatag ccttgcgcct
      121 ctagtgttat gtgatgttaa taagttggct acaagtcgct attccataaa catatggttt
      181 aaattgtcgc gaaccgtacc tgctcatatc attgtaagag gtattattga cgttggtgga
      241 ttcggacgca aaactgtcag atttttcgat ataaaaatta acgtttgcga tttattgcat
      301 tggagttcat cgtctgtgtt tttagttaga caagttatgg acataataag aagaaacgga
      361 aatcttccac tatcgtgtcc aattgaagcg gataagatgt acaacctgac aaacttagtc
      421 ataacagatg agctatttcc catgtataca cctgctattc atttgaatgt cactgtgaat
      481 ttctatgata aggaaaagct tttggtcaca tatctgctgc ggggatatac cattccaaga
      541 aacaaaagaa aattttga