Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367164 558 bp mRNA linear INV 02-SEP-2023 (LOC131996958), mRNA. ACCESSION XM_059367164 VERSION XM_059367164.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..558 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..558 /gene="LOC131996958" /note="uncharacterized LOC131996958; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131996958" CDS 1..558 /gene="LOC131996958" /codon_start=1 /product="uncharacterized protein LOC131996958" /protein_id="XP_059223147.1" /db_xref="GeneID:131996958" /translation="MFRVKTYEDQACLRSSSAGKRPFEVVVHNVTCSTFDSLAPLVLC DVNKLATSRYSINIWFKLSRTVPAHIIVRGIIDVGGFGRKTVRFFDIKINVCDLLHWS SSSVFLVRQVMDIIRRNGNLPLSCPIEADKMYNLTNLVITDELFPMYTPAIHLNVTVN FYDKEKLLVTYLLRGYTIPRNKRKF" ORIGIN 1 atgtttcgcg tcaaaacata cgaagatcaa gcctgcttgc gcagcagttc agccggcaag 61 cgaccctttg aagtggtagt ccataatgtc acttgttcaa cctttgatag ccttgcgcct 121 ctagtgttat gtgatgttaa taagttggct acaagtcgct attccataaa catatggttt 181 aaattgtcgc gaaccgtacc tgctcatatc attgtaagag gtattattga cgttggtgga 241 ttcggacgca aaactgtcag atttttcgat ataaaaatta acgtttgcga tttattgcat 301 tggagttcat cgtctgtgtt tttagttaga caagttatgg acataataag aagaaacgga 361 aatcttccac tatcgtgtcc aattgaagcg gataagatgt acaacctgac aaacttagtc 421 ataacagatg agctatttcc catgtataca cctgctattc atttgaatgt cactgtgaat 481 ttctatgata aggaaaagct tttggtcaca tatctgctgc ggggatatac cattccaaga 541 aacaaaagaa aattttga