Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367163 447 bp mRNA linear INV 02-SEP-2023 (LOC131996957), mRNA. ACCESSION XM_059367163 VERSION XM_059367163.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..447 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..447 /gene="LOC131996957" /note="uncharacterized LOC131996957; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996957" CDS 1..447 /gene="LOC131996957" /codon_start=1 /product="uncharacterized protein LOC131996957" /protein_id="XP_059223146.1" /db_xref="GeneID:131996957" /translation="MDCVSTIKYECSIAKLAISHYNMGMMFELSKDMPRNMDFGLVIY VKPKKGLKYIKFMDTKVNICILLEHGMSVPMLNYLMERVTRNSNVPISCPIRGNSIYN ITNVEIASDFFPSYTPIIEFNFSLNLFDNKKRYATYIIEGETKRKS" ORIGIN 1 atggattgtg tgtccacaat aaagtatgaa tgtagtattg caaaattggc cattagccac 61 tacaacatgg gcatgatgtt tgaactctcc aaggatatgc ctagaaacat ggattttgga 121 ttggtgattt atgttaaacc taaaaagggt cttaaataca tcaaatttat ggatacaaag 181 gtcaatatat gtattctatt ggagcatggt atgtccgtac ccatgttaaa ctatctcatg 241 gagagagtta ctagaaatag taatgtccca atatcgtgtc ccatacgagg gaattccatt 301 tataatataa caaatgtgga aattgcttcg gatttctttc catcttatac accaatcatt 361 gagtttaatt tttcgttaaa tttattcgac aataaaaaac gatatgccac ttacatcatt 421 gagggagaaa caaaacgaaa atcataa