PREDICTED: Stomoxys calcitrans uncharacterized LOC131996957

LOCUS       XM_059367163             447 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996957), mRNA.
ACCESSION   XM_059367163
VERSION     XM_059367163.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..447
                     /gene="LOC131996957"
                     /note="uncharacterized LOC131996957; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996957"
     CDS             1..447
                     /gene="LOC131996957"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996957"
                     /protein_id="XP_059223146.1"
                     /db_xref="GeneID:131996957"
                     /translation="MDCVSTIKYECSIAKLAISHYNMGMMFELSKDMPRNMDFGLVIY
                     VKPKKGLKYIKFMDTKVNICILLEHGMSVPMLNYLMERVTRNSNVPISCPIRGNSIYN
                     ITNVEIASDFFPSYTPIIEFNFSLNLFDNKKRYATYIIEGETKRKS"
ORIGIN      
        1 atggattgtg tgtccacaat aaagtatgaa tgtagtattg caaaattggc cattagccac
       61 tacaacatgg gcatgatgtt tgaactctcc aaggatatgc ctagaaacat ggattttgga
      121 ttggtgattt atgttaaacc taaaaagggt cttaaataca tcaaatttat ggatacaaag
      181 gtcaatatat gtattctatt ggagcatggt atgtccgtac ccatgttaaa ctatctcatg
      241 gagagagtta ctagaaatag taatgtccca atatcgtgtc ccatacgagg gaattccatt
      301 tataatataa caaatgtgga aattgcttcg gatttctttc catcttatac accaatcatt
      361 gagtttaatt tttcgttaaa tttattcgac aataaaaaac gatatgccac ttacatcatt
      421 gagggagaaa caaaacgaaa atcataa