PREDICTED: Stomoxys calcitrans uncharacterized LOC131996954

LOCUS       XM_059367160             567 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996954), mRNA.
ACCESSION   XM_059367160
VERSION     XM_059367160.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..567
                     /gene="LOC131996954"
                     /note="uncharacterized LOC131996954; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996954"
     CDS             1..567
                     /gene="LOC131996954"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996954"
                     /protein_id="XP_059223143.1"
                     /db_xref="GeneID:131996954"
                     /translation="MSPKIIQRSIFVLIALMSLNTIRCGKRPFTIVFHNVSCPTFDPI
                     CQLAECDLKKLGTSRYSLSGMFKLSRTMPEHIVGRAMIHVRGIKRNRTITFLDVKMKM
                     CDLLRHTNYMPLVDQIMNEVRRVTNLPMSCPVEGNVMYNVTNVIITDDLFPVYAPPVY
                     FNVTIDFFDRNKLLALYRLQGSILPKYK"
ORIGIN      
        1 atgtctccga aaatcataca gagaagcatt ttcgttctta tagcgttgat gagtttaaat
       61 acaatcaggt gcggaaaacg tccttttaca attgtgttcc ataatgtttc atgtcccacc
      121 tttgatccaa tttgccagct ggctgagtgt gatttaaaaa agcttggcac cagccgctat
      181 tctctaagcg gtatgtttaa attgtcaagg actatgcctg aacatatcgt gggcagggct
      241 atgattcatg tgagaggaat caaacgaaat cgaactataa catttttgga tgtgaagatg
      301 aaaatgtgtg atttattaag acatacaaat tacatgccac ttgttgatca gatcatgaat
      361 gaagtaagaa gggtcactaa cttaccgatg tcatgtcctg tagaagggaa tgtcatgtac
      421 aacgttacta acgtcattat tacggatgac ctatttccag tatacgcacc acctgtttat
      481 ttcaatgtta ctattgattt tttcgatagg aataaacttc ttgcattata tcgcctgcag
      541 ggatccatat taccaaaata taaatga