Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088026


LOCUS       XM_059367159             842 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088026), mRNA.
ACCESSION   XM_059367159
VERSION     XM_059367159.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 29% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..842
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..842
                     /gene="LOC106088026"
                     /note="uncharacterized LOC106088026; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088026"
     CDS             1..675
                     /gene="LOC106088026"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088026"
                     /protein_id="XP_059223142.1"
                     /db_xref="GeneID:106088026"
                     /translation="MRSLRDNRINLNTTFGIYTRHVRPLAHLRRKGNGGDDVFPYKMF
                     NKLIFCMFIFDSLNLIEGGKRPFVVVFHNVTCLTFDSICPEAECDLIKLGTSRYSLNV
                     MFKLSRTLPQHLEARALISIKGFTRNDTVTFLDVKMNICDLIQHVKYVPLIDQIMNKL
                     RRVTNVPMSCPVKGNTMYNITNLVITDELFPVYAPPIHFNVTINFLDNKKLLALYRLQ
                     GTIAKA"
     polyA_site      842
                     /gene="LOC106088026"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgcgttccc tcagggataa taggataaat ctcaacacta cattcggtat ctacacaaga
       61 cacgtaaggc cgctagcgca cctgcgcagg aaaggcaatg gtggtgatga tgtgtttccc
      121 tataaaatgt ttaataaact cattttctgt atgttcatat tcgatagttt aaatttaatt
      181 gagggcggaa aacgcccctt cgttgtggtg ttccataatg tcacatgtct cacctttgac
      241 tcaatttgtc cggaagcaga gtgtgattta attaaattgg gcaccagtcg ctattccctg
      301 aatgtaatgt tcaagctttc gaggacattg ccacaacatc ttgaggccag agctcttatt
      361 agtattaaag gatttacacg aaatgacact gtgacatttt tagacgtcaa gatgaatata
      421 tgtgatctta tacaacatgt aaagtacgtg cctcttatcg atcagatcat gaacaagtta
      481 agaagagtca ccaatgtgcc aatgtcatgt cctgttaagg ggaacaccat gtacaacatt
      541 actaacttgg ttataacgga tgaactgttt ccagtgtacg ccccacctat tcatttcaat
      601 gttactatta actttttgga taacaaaaaa ttgttggcat tatatcgact acaggggact
      661 atagcaaaag catgaggaat tgttgcattc acccatattg ttgctatgca agttgatatc
      721 ttatgagaga tcttatatct gtatgaacat acttgctgtg gtcacaacta actgtatgtt
      781 tgttgtttta tgtattgaat ttttggtata tattgaaata aactacactt gtgccaaaac
      841 ca