Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367159 842 bp mRNA linear INV 02-SEP-2023 (LOC106088026), mRNA. ACCESSION XM_059367159 VERSION XM_059367159.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 29% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..842 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..842 /gene="LOC106088026" /note="uncharacterized LOC106088026; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088026" CDS 1..675 /gene="LOC106088026" /codon_start=1 /product="uncharacterized protein LOC106088026" /protein_id="XP_059223142.1" /db_xref="GeneID:106088026" /translation="MRSLRDNRINLNTTFGIYTRHVRPLAHLRRKGNGGDDVFPYKMF NKLIFCMFIFDSLNLIEGGKRPFVVVFHNVTCLTFDSICPEAECDLIKLGTSRYSLNV MFKLSRTLPQHLEARALISIKGFTRNDTVTFLDVKMNICDLIQHVKYVPLIDQIMNKL RRVTNVPMSCPVKGNTMYNITNLVITDELFPVYAPPIHFNVTINFLDNKKLLALYRLQ GTIAKA" polyA_site 842 /gene="LOC106088026" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgcgttccc tcagggataa taggataaat ctcaacacta cattcggtat ctacacaaga 61 cacgtaaggc cgctagcgca cctgcgcagg aaaggcaatg gtggtgatga tgtgtttccc 121 tataaaatgt ttaataaact cattttctgt atgttcatat tcgatagttt aaatttaatt 181 gagggcggaa aacgcccctt cgttgtggtg ttccataatg tcacatgtct cacctttgac 241 tcaatttgtc cggaagcaga gtgtgattta attaaattgg gcaccagtcg ctattccctg 301 aatgtaatgt tcaagctttc gaggacattg ccacaacatc ttgaggccag agctcttatt 361 agtattaaag gatttacacg aaatgacact gtgacatttt tagacgtcaa gatgaatata 421 tgtgatctta tacaacatgt aaagtacgtg cctcttatcg atcagatcat gaacaagtta 481 agaagagtca ccaatgtgcc aatgtcatgt cctgttaagg ggaacaccat gtacaacatt 541 actaacttgg ttataacgga tgaactgttt ccagtgtacg ccccacctat tcatttcaat 601 gttactatta actttttgga taacaaaaaa ttgttggcat tatatcgact acaggggact 661 atagcaaaag catgaggaat tgttgcattc acccatattg ttgctatgca agttgatatc 721 ttatgagaga tcttatatct gtatgaacat acttgctgtg gtcacaacta actgtatgtt 781 tgttgtttta tgtattgaat ttttggtata tattgaaata aactacactt gtgccaaaac 841 ca