Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans G8 domain-containing protein


LOCUS       XM_059367147            1086 bp    mRNA    linear   INV 02-SEP-2023
            DDB_G0286311-like (LOC131996944), mRNA.
ACCESSION   XM_059367147
VERSION     XM_059367147.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1086
                     /gene="LOC131996944"
                     /note="G8 domain-containing protein DDB_G0286311-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon."
                     /db_xref="GeneID:131996944"
     CDS             1..858
                     /gene="LOC131996944"
                     /codon_start=1
                     /product="G8 domain-containing protein DDB_G0286311-like"
                     /protein_id="XP_059223130.1"
                     /db_xref="GeneID:131996944"
                     /translation="MLGMQAYYNETNIIFNILVPNVSEEDYFLYHIIPLPINITKLII
                     TEPYILFNENSTHHHKTLCPSIEGTYYCGIPIRQEETKYSLCIGNLINNKEANCPISD
                     VGKRESITQVEQNLILFIHSPETLINSTCSIKTLTVKDTALVRFQNCDVSINGITYHD
                     DTDAYWDQLHIPPLPNSNISVNSTIEILSLQKLEDFNFLTNNRISNLEITTTTVHSVT
                     TTTTLPITPTTTSSLWPSLYLKGGGVTTPTLLSPPKPVTTPTLLSPPKPVTTPTLLSP
                     PKPPRTLTY"
     polyA_site      1086
                     /gene="LOC131996944"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgctaggca tgcaagccta ctacaatgaa acaaatatca tttttaatat tcttgtaccg
       61 aatgtctctg aagaagacta ttttttatac cacataattc ctttaccaat aaacataact
      121 aagttaataa taacagaacc atatatactg tttaatgaaa attccacaca ccatcacaaa
      181 acactttgcc catcgatcga aggaacatat tattgcggta taccgatccg acaggaagaa
      241 accaaatact cgttatgtat tggaaactta ataaacaata aagaagcaaa ttgcccaatt
      301 agtgacgttg gaaaaaggga atcgatcaca caagtggaac aaaacctaat actttttata
      361 cactcaccag agacactaat aaattctact tgcagtatca aaactctcac agtaaaagac
      421 acagcccttg tgcgtttcca gaactgtgac gtctcaataa atggtataac ataccacgat
      481 gataccgatg catattggga tcaactccac atacccccgt taccaaacag caacatttcc
      541 gtaaactcca caatcgaaat acttagtctt caaaaactcg aggatttcaa ctttctaacc
      601 aacaacagaa ttagcaacct ggaaataacc actacaacag ttcactcagt cacaacaaca
      661 acaacattac ctatcactcc gaccacaaca tcttcattgt ggccgtcgct ctatcttaag
      721 gggggaggag ttacgacacc caccttattg tctccaccaa aaccagttac gacacccacc
      781 ttattgtctc caccaaaacc agttacgaca cccaccttat tatctccacc aaaaccaccg
      841 agaacgttaa cctattgatt taggtcataa ttaacgctga ataaccaata aatatatttg
      901 tctcatataa ccaatatcat tgttaacacc aactaattaa taagaaattg ttttgtaact
      961 tttattgtat aattccaaga aatctagctt ttactttaat catcatttat tatattgtaa
     1021 cttagttttc tttaagattt aaaatgaaaa taaaaattat tctttgttca gacttcaaat
     1081 tgcaaa