Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367147 1086 bp mRNA linear INV 02-SEP-2023 DDB_G0286311-like (LOC131996944), mRNA. ACCESSION XM_059367147 VERSION XM_059367147.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 10% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1086 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1086 /gene="LOC131996944" /note="G8 domain-containing protein DDB_G0286311-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996944" CDS 1..858 /gene="LOC131996944" /codon_start=1 /product="G8 domain-containing protein DDB_G0286311-like" /protein_id="XP_059223130.1" /db_xref="GeneID:131996944" /translation="MLGMQAYYNETNIIFNILVPNVSEEDYFLYHIIPLPINITKLII TEPYILFNENSTHHHKTLCPSIEGTYYCGIPIRQEETKYSLCIGNLINNKEANCPISD VGKRESITQVEQNLILFIHSPETLINSTCSIKTLTVKDTALVRFQNCDVSINGITYHD DTDAYWDQLHIPPLPNSNISVNSTIEILSLQKLEDFNFLTNNRISNLEITTTTVHSVT TTTTLPITPTTTSSLWPSLYLKGGGVTTPTLLSPPKPVTTPTLLSPPKPVTTPTLLSP PKPPRTLTY" polyA_site 1086 /gene="LOC131996944" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgctaggca tgcaagccta ctacaatgaa acaaatatca tttttaatat tcttgtaccg 61 aatgtctctg aagaagacta ttttttatac cacataattc ctttaccaat aaacataact 121 aagttaataa taacagaacc atatatactg tttaatgaaa attccacaca ccatcacaaa 181 acactttgcc catcgatcga aggaacatat tattgcggta taccgatccg acaggaagaa 241 accaaatact cgttatgtat tggaaactta ataaacaata aagaagcaaa ttgcccaatt 301 agtgacgttg gaaaaaggga atcgatcaca caagtggaac aaaacctaat actttttata 361 cactcaccag agacactaat aaattctact tgcagtatca aaactctcac agtaaaagac 421 acagcccttg tgcgtttcca gaactgtgac gtctcaataa atggtataac ataccacgat 481 gataccgatg catattggga tcaactccac atacccccgt taccaaacag caacatttcc 541 gtaaactcca caatcgaaat acttagtctt caaaaactcg aggatttcaa ctttctaacc 601 aacaacagaa ttagcaacct ggaaataacc actacaacag ttcactcagt cacaacaaca 661 acaacattac ctatcactcc gaccacaaca tcttcattgt ggccgtcgct ctatcttaag 721 gggggaggag ttacgacacc caccttattg tctccaccaa aaccagttac gacacccacc 781 ttattgtctc caccaaaacc agttacgaca cccaccttat tatctccacc aaaaccaccg 841 agaacgttaa cctattgatt taggtcataa ttaacgctga ataaccaata aatatatttg 901 tctcatataa ccaatatcat tgttaacacc aactaattaa taagaaattg ttttgtaact 961 tttattgtat aattccaaga aatctagctt ttactttaat catcatttat tatattgtaa 1021 cttagttttc tttaagattt aaaatgaaaa taaaaattat tctttgttca gacttcaaat 1081 tgcaaa