Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized protein K02A2.6-like


LOCUS       XM_059367145             948 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996942), mRNA.
ACCESSION   XM_059367145
VERSION     XM_059367145.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..948
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..948
                     /gene="LOC131996942"
                     /note="uncharacterized protein K02A2.6-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:131996942"
     CDS             1..948
                     /gene="LOC131996942"
                     /codon_start=1
                     /product="uncharacterized protein K02A2.6-like"
                     /protein_id="XP_059223128.1"
                     /db_xref="GeneID:131996942"
                     /translation="MEDGKERPIAYASQTLSVTERKYPQFDIEALAIVWAAQKFFLYL
                     YARHFTLITDHKPLPQILHPDKGLPTDTKTNINADFCSRAIDTNMIGKIREEYDEFDN
                     FVIRQMQQLPTTPERIASETRKDDELGKIVRLLEAGKCLKSHGYKSPVVNYKLFGDCL
                     VFEHRVVIPPKLQHNVLKDLHAAHQGVVKMKDVARYFVYWPGLDKHIEDVAKACDECG
                     RFANVPVKFGGHHWQYPKQPWERINIDWWSFCGKNVITSAYSKWIEVKITPSTSSAAT
                     INALDELFSSFGDTITVVSDNGMGFSSAEFKDYLTRIGV"
ORIGIN      
        1 atggaggatg gtaaagagag gccgatagca tatgctagcc agacattgtc ggtcactgaa
       61 cggaaatatc cacaatttga tatagaagct ctggctattg tgtgggcagc acagaagttt
      121 tttctttatt tgtatgcaag acatttcaca ttgataacgg atcataagcc attgccgcag
      181 attttgcatc ctgataaagg ccttccaacg gatactaaga ctaatatcaa tgctgatttc
      241 tgctcaagag caattgatac gaacatgatt ggcaagatcc gagaagaata tgacgaattc
      301 gataattttg taataagaca aatgcagcaa ttgcccacaa ccccagagcg aatcgcttcg
      361 gaaactcgta aagatgacga attgggcaaa atagtgaggt tattggaggc tgggaaatgc
      421 ctcaaatcgc atggatataa atcaccagtt gtaaattata aacttttcgg tgattgttta
      481 gtatttgagc accgtgttgt aattccaccg aaactccaac acaacgtact taaagacctt
      541 cacgccgctc atcaaggcgt tgttaaaatg aaagacgtcg ccaggtattt cgtttactgg
      601 ccagggttgg ataagcatat agaagatgta gccaaggcat gtgatgaatg tggacgattt
      661 gcaaatgtac cagtgaagtt tggtggacat cattggcagt atccaaagca accatgggaa
      721 cgaatcaaca ttgattggtg gtccttttgt gggaagaatg ttattacaag cgcttacagt
      781 aagtggattg aagttaagat aacgccatca acttcgtcag cagctacgat taatgccttg
      841 gatgagctat tttcaagctt tggagatacg attacggtcg tatcggacaa tggaatgggt
      901 ttttcatctg cagaattcaa ggattatttg acgcgaattg gagtgtaa