Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367145 948 bp mRNA linear INV 02-SEP-2023 (LOC131996942), mRNA. ACCESSION XM_059367145 VERSION XM_059367145.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..948 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..948 /gene="LOC131996942" /note="uncharacterized protein K02A2.6-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131996942" CDS 1..948 /gene="LOC131996942" /codon_start=1 /product="uncharacterized protein K02A2.6-like" /protein_id="XP_059223128.1" /db_xref="GeneID:131996942" /translation="MEDGKERPIAYASQTLSVTERKYPQFDIEALAIVWAAQKFFLYL YARHFTLITDHKPLPQILHPDKGLPTDTKTNINADFCSRAIDTNMIGKIREEYDEFDN FVIRQMQQLPTTPERIASETRKDDELGKIVRLLEAGKCLKSHGYKSPVVNYKLFGDCL VFEHRVVIPPKLQHNVLKDLHAAHQGVVKMKDVARYFVYWPGLDKHIEDVAKACDECG RFANVPVKFGGHHWQYPKQPWERINIDWWSFCGKNVITSAYSKWIEVKITPSTSSAAT INALDELFSSFGDTITVVSDNGMGFSSAEFKDYLTRIGV" ORIGIN 1 atggaggatg gtaaagagag gccgatagca tatgctagcc agacattgtc ggtcactgaa 61 cggaaatatc cacaatttga tatagaagct ctggctattg tgtgggcagc acagaagttt 121 tttctttatt tgtatgcaag acatttcaca ttgataacgg atcataagcc attgccgcag 181 attttgcatc ctgataaagg ccttccaacg gatactaaga ctaatatcaa tgctgatttc 241 tgctcaagag caattgatac gaacatgatt ggcaagatcc gagaagaata tgacgaattc 301 gataattttg taataagaca aatgcagcaa ttgcccacaa ccccagagcg aatcgcttcg 361 gaaactcgta aagatgacga attgggcaaa atagtgaggt tattggaggc tgggaaatgc 421 ctcaaatcgc atggatataa atcaccagtt gtaaattata aacttttcgg tgattgttta 481 gtatttgagc accgtgttgt aattccaccg aaactccaac acaacgtact taaagacctt 541 cacgccgctc atcaaggcgt tgttaaaatg aaagacgtcg ccaggtattt cgtttactgg 601 ccagggttgg ataagcatat agaagatgta gccaaggcat gtgatgaatg tggacgattt 661 gcaaatgtac cagtgaagtt tggtggacat cattggcagt atccaaagca accatgggaa 721 cgaatcaaca ttgattggtg gtccttttgt gggaagaatg ttattacaag cgcttacagt 781 aagtggattg aagttaagat aacgccatca acttcgtcag cagctacgat taatgccttg 841 gatgagctat tttcaagctt tggagatacg attacggtcg tatcggacaa tggaatgggt 901 ttttcatctg cagaattcaa ggattatttg acgcgaattg gagtgtaa