PREDICTED: Stomoxys calcitrans uncharacterized LOC131996939

LOCUS       XM_059367142             696 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996939), mRNA.
ACCESSION   XM_059367142
VERSION     XM_059367142.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..696
                     /gene="LOC131996939"
                     /note="uncharacterized LOC131996939; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996939"
     CDS             1..696
                     /gene="LOC131996939"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996939"
                     /protein_id="XP_059223125.1"
                     /db_xref="GeneID:131996939"
                     /translation="MGCSKVNCKSSTSGDSMVSCWLCLDSYHDKCVELSVRTADNLRE
                     NKGLRWCCIKCRAYDAEFYSFFKTTRIEFNKISLELNSVLEKFNKYKQVFDNSSRLDQ
                     FLQSPSDSLRKRKKPSDITVRTAANDETNVISVPKINLPDTFSTSVSSSKPTDANKLT
                     AEVIPSGTNQFYSPLTSPKSPNAPNTPASPNLRVVVPKKTIFAARFAAETSENDIISY
                     INSKIGSNHEIKL"
ORIGIN      
        1 atgggctgtt caaaagttaa ctgcaaaagt tcgacgtctg gggattcgat ggtatcatgt
       61 tggctctgtc tggactctta tcacgacaaa tgtgtagaat tatccgtccg aactgctgat
      121 aatctaagag aaaataaagg tctacgttgg tgctgtatta aatgtcgtgc gtacgatgct
      181 gaattttatt cctttttcaa aactacacgt atagagttta ataaaatatc cctggaactc
      241 aactctgtct tggaaaagtt caataaatac aaacaagtat ttgataactc atcccgtttg
      301 gatcagttcc ttcaatctcc ttctgattct ttacgcaaaa gaaagaagcc atccgatatt
      361 actgtccgta ctgcagcaaa cgatgaaaca aatgtcatat ctgttccgaa aatcaatctt
      421 ccggatactt tctctacaag tgtatcctcg tcaaaaccta ccgatgcaaa caaattaaca
      481 gcggaagtta ttccatccgg aactaatcaa ttttattccc ctctaacttc gccgaaatct
      541 ccaaatgctc cgaatactcc ggctagtccc aatttacgtg ttgtcgtacc gaagaaaact
      601 atatttgctg cccgttttgc ggctgaaact tctgagaacg atataatttc atatattaat
      661 agtaaaattg gctctaatca tgagataaag ctgtaa