PREDICTED: Stomoxys calcitrans uncharacterized LOC131996938

LOCUS       XM_059367141             780 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996938), mRNA.
ACCESSION   XM_059367141
VERSION     XM_059367141.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..780
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..780
                     /gene="LOC131996938"
                     /note="uncharacterized LOC131996938; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996938"
     CDS             1..780
                     /gene="LOC131996938"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996938"
                     /protein_id="XP_059223124.1"
                     /db_xref="GeneID:131996938"
                     /translation="MDADDRESMEANMKNVLENQHNLKYLAEKQTSVVEATLNVLKKT
                     TDEINGQFKELNEKVQNISQMLNTDYSLFKKAMDFFAVADQLSSLFTEVEHIQARVIG
                     LLIDINHGKVNPNLVRPNQLQAEVMKIKDQLPKGLRLPGEKDDVLQAIYKVMTAHGLL
                     VEEKLVIDVQIPLVEKSSAEIFRVVPLPMVRNGTAMVAALRQQFLAYNYEMDAYHLLS
                     QSSMNQCQLTGEDEFLCRGNWAWEDANDHSCELAALKPTIM"
ORIGIN      
        1 atggatgcgg acgacagaga gagtatggaa gcaaatatga aaaatgtact tgaaaatcag
       61 cacaacttga aatatttggc tgagaagcaa acgtctgtgg tggaagcaac gcttaatgtg
      121 ctgaaaaaga ccacggatga aataaatgga cagtttaaag agctgaatga gaaggtgcaa
      181 aacataagtc agatgctgaa cactgactat tccctcttca aaaaggcgat ggacttcttc
      241 gcggtagccg atcaacttag cagcttgttt actgaagtgg aacatattca agccagggta
      301 attggcttat taattgacat caaccatgga aaagtaaatc caaatttagt acggccaaac
      361 cagttgcagg cagaggtgat gaaaataaag gatcagctac ctaaaggact aaggttgcct
      421 ggtgagaagg acgatgtttt gcaggcaata tacaaggtga tgacggcgca tggtctgctg
      481 gtggaagaaa aattagtgat tgacgtgcag attcccttgg tagaaaaatc atcagcagaa
      541 atattccgcg tcgtaccact gccgatggtg agaaacggaa ccgcaatggt agcagcttta
      601 agacagcagt tcctggccta caactatgaa atggatgctt atcatctact gtcgcagtca
      661 tcgatgaacc aatgtcagct aactggtgaa gatgaatttc tttgcagagg caactgggcc
      721 tgggaagacg ccaacgatca ttcatgtgag ctagcagcgc ttaagccaac aattatgtaa