Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367138 771 bp mRNA linear INV 02-SEP-2023 (LOC131996935), mRNA. ACCESSION XM_059367138 VERSION XM_059367138.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..771 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..771 /gene="LOC131996935" /note="uncharacterized LOC131996935; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131996935" CDS 1..771 /gene="LOC131996935" /codon_start=1 /product="uncharacterized protein LOC131996935" /protein_id="XP_059223121.1" /db_xref="GeneID:131996935" /translation="MATENENNALELSRVAVRVPPFWRQNPRLWFIQLESQFVTSGIS SDETKFHTLVGSMESGILNHVNHIVENPPAVNKYEVLKKALVDEFMESEVKRLRQLLE NVCIGDKKPSALLREILELSCGKVSKELLKTLWIQRLPSTTRAILSVSDDGVDKLAIM ADKIHDQSDASGVVNAVSTKDEDRLMILERQVSELLSKIDAFSFRGGQHEKRNSTHRS RSNSRSRSTSSVCWYHYKFGQKATKCRSPCSFNSTENN" ORIGIN 1 atggctactg aaaatgaaaa taatgcattg gagttatccc gtgtagcggt tcgagttcct 61 ccgttttggc gacaaaatcc gcggctatgg tttatacaat tggagtccca gtttgttaca 121 tcaggaattt cttccgacga aacgaagttc catacgctag ttgggtccat ggaaagcggt 181 attttgaacc atgtaaacca tattgtggaa aatcctccag cggtcaacaa atacgaagtc 241 ttgaagaagg cattggttga tgaatttatg gaatctgagg taaaacgcct tcgacaactt 301 ttggaaaatg tatgtatcgg tgacaagaaa ccttcagcat tactaaggga aatattggaa 361 ttgtcctgtg gaaaagtgtc aaaagagtta ttgaaaacat tgtggatcca gcgccttcca 421 tcaacaacaa gagccatact gtcggtaagc gatgatggag tagacaagtt agcaatcatg 481 gcagataaaa tccatgacca gtctgatgct tctggtgtag tcaatgctgt ttcaactaag 541 gatgaagacc gtttgatgat tttggaaagg caagtaagtg aacttttatc gaaaattgat 601 gccttttcgt tcagaggtgg tcaacacgaa aaaaggaatt ccacacatcg ttcacgaagt 661 aattcacgct ctcgttcaac atcttctgtg tgttggtacc actataaatt tggacagaaa 721 gcgacaaaat gccgttcgcc ctgctcgttc aattcgacgg aaaacaatta g