Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996934


LOCUS       XM_059367136             771 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996934), mRNA.
ACCESSION   XM_059367136
VERSION     XM_059367136.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..771
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..771
                     /gene="LOC131996934"
                     /note="uncharacterized LOC131996934; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:131996934"
     CDS             1..771
                     /gene="LOC131996934"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996934"
                     /protein_id="XP_059223119.1"
                     /db_xref="GeneID:131996934"
                     /translation="MATENENNALELSRVAVRVPPFWRQNPRLWFIQLESQFVTSGIS
                     SDETKFHTLVGSMESGILNHVSHIVENPPAVNKYEVLKKALLDEFMESEEKRLRQLLE
                     NVCIGDKKPSALLREMMELSCGKVSKELLKTLWIQRLPSTTRAILSVSNDGVDKLAIM
                     ADKIHDQSDASGVVNAVSTKDEDRLMVLERQVSELLSKIDAFSFRGGQHEKRNSTHRS
                     RSNSRSRSTSSVCWYHLKFGRKATKCRSPWSFNSTENN"
ORIGIN      
        1 atggctactg aaaatgaaaa taatgcattg gagttatccc gtgtagcggt tcgagttcct
       61 ccgttttggc gacaaaatcc gcggctatgg tttatacaat tggagtccca gtttgttaca
      121 tcaggaattt cctcggacga aacgaagttc catacgctag ttgggtccat ggaaagcggt
      181 attttgaacc atgtaagcca tattgtggaa aatcctccag cggtcaacaa atacgaagtc
      241 ttgaagaagg cattgcttga tgaatttatg gaatctgagg aaaaacgcct tcgacaactt
      301 ttggaaaatg tatgtatcgg tgacaagaaa ccttcagcat tactaaggga aatgatggaa
      361 ttgtcctgtg gaaaagtgtc aaaagagtta ttgaaaacat tgtggatcca gcgccttcca
      421 tcaacaacaa gagccatact gtcggtaagc aatgatggag tagacaagtt agcaatcatg
      481 gcagataaaa tccatgacca atctgatgct tctggtgtag tcaatgctgt ttcaactaag
      541 gatgaagacc gtttgatggt tttggaaagg caagtaagtg aacttttatc gaaaattgat
      601 gccttttcgt tcagaggtgg tcaacacgaa aaaaggaatt ccacacatcg ttcacgaagt
      661 aattcacgct ctcgttcaac atcttctgtg tgttggtatc accttaaatt tggacggaaa
      721 gcgacaaaat gccgttcgcc ctggtcgttc aattcgacgg aaaacaatta g