PREDICTED: Stomoxys calcitrans uncharacterized LOC131996931

LOCUS       XM_059367134             681 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996931), mRNA.
ACCESSION   XM_059367134
VERSION     XM_059367134.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..681
                     /gene="LOC131996931"
                     /note="uncharacterized LOC131996931; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996931"
     CDS             1..681
                     /gene="LOC131996931"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996931"
                     /protein_id="XP_059223117.1"
                     /db_xref="GeneID:131996931"
                     /translation="MRALIDQGSQRASISEEAAQILRLPRKKLITDLVGLGNTTVGRS
                     KSTIQIEIKPRFQSDAVHVIDAMVWSTLSSAQPDKNLDVSVDGWRNYCLADPLFYKSD
                     RIVLLIGADLYHEIIQNGVVKIGSLSGQETSLVLIICGSVCGHGSENIVMAVTKELER
                     FWEMEEVNEDDDSKEDKCEQLFTTSTQINEDNRLVVRLPFKEDIELGDSRKVALARFL
                     NLEKKMQI"
ORIGIN      
        1 atgagagccc taattgatca aggttctcaa cgtgcgtcta tatcggaaga ggcagctcaa
       61 atattgagat tacccaggaa aaagctaatt acggatttag ttggtcttgg taatacaaca
      121 gtcggcagat cgaaatcaac aattcaaatt gaaataaaac cgcggttcca gagcgatgca
      181 gttcacgtga tagatgctat ggtgtggtca acattatcgt cagcgcaacc tgataaaaac
      241 ctggacgtca gtgtggatgg ctggagaaat tactgtttgg ctgatccact tttctataag
      301 tctgatagga ttgtcttgtt aattggtgca gatctttatc atgagattat ccagaatggt
      361 gtagtcaaga ttggttcgtt atctggacaa gaaacatccc ttgtgctcat aatctgtggc
      421 agcgtttgcg gacatggatc tgaaaatatt gtgatggcgg taacaaaaga gctggaaagg
      481 ttttgggaaa tggaagaagt gaatgaagat gacgactcta aggaagataa atgcgagcag
      541 ctctttacta cgtcaacaca aataaatgag gacaacagat tggtggtgag attaccattc
      601 aaggaggaca tcgagttagg tgattcaaga aaagtggcct tagcacgttt cttaaatctc
      661 gaaaaaaaaa tgcaaatttg a