Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088932


LOCUS       XM_059367127            1201 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088932), mRNA.
ACCESSION   XM_059367127
VERSION     XM_059367127.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1201
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1201
                     /gene="LOC106088932"
                     /note="uncharacterized LOC106088932; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088932"
     CDS             299..1201
                     /gene="LOC106088932"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088932"
                     /protein_id="XP_059223110.1"
                     /db_xref="GeneID:106088932"
                     /translation="MNSIEKSKLQRGKTTFVCRLCRRPHGLRVCKRFQNLNVSERLAA
                     VKKYGYCTNCLAHSHSQGSCFTRTGCTHCHEKHHSLLHVNSRLRKSLSSSSTKTDQRK
                     MSRHSSIGIQPTTATRREKTDTKESCEKDSLPSISMSLSSILQQNAATLLPTAIVKIQ
                     TKEGKRLARCLLDTASRMSWISKKFADKLNLTTLELDNEIICPVTLWSCVDSNYKLKA
                     TLRVNNRISTTTPKKSLPESIKSNFQNLILADSNFYKSSAIDIVVGVDIYSRIVLDGI
                     YIKTGLPTAQNTAFGMILYGTFSP"
ORIGIN      
        1 atttgtcgca tcgttattgt caaaatcgat taaatacatt attgagctac cattatacga
       61 agacataatt cataactaaa aggatctgat tggaaacaca atattatctg caccaacaaa
      121 gtgaaaagga agcgcataat ccctgttcat caaatttaca ttttcctacg tttaagcgga
      181 taaagtgtgg attttaagcc gtagccaaaa aagccgaata taccgacaac gaggcattaa
      241 tttgggaacc caggtacttt catggactct ttactgtgag ttgggtttgc taagcagtat
      301 gaactccatt gaaaaatcaa agctacagag gggcaaaaca acatttgttt gcagattatg
      361 tcgaaggcct catggactta gggtctgtaa gagatttcaa aacttgaacg tatcggaaag
      421 attggcagct gtgaagaaat atgggtattg tacaaattgc ctcgcccatt cccactctca
      481 ggggtcctgt ttcacaagga cgggctgtac acattgccat gaaaaacatc attcactcct
      541 tcatgtgaat tcacgacttc gtaaaagttt gtcttcttct tctactaaaa cggatcaacg
      601 gaaaatgtct agacactcat ctattggaat tcaaccaaca acggccacgc ggagggaaaa
      661 aaccgatacg aaagagtcct gtgaaaagga cagtttgcct tcaatttcca tgtctctcag
      721 ttcaattctt caacaaaatg cagcaacttt gcttcctaca gctattgtaa aaattcagac
      781 aaaagaagga aaacgtctag cccgatgttt gctggacacg gcctcccgca tgagttggat
      841 ttccaaaaag tttgcagaca agctaaattt aacaacccta gagctggaca atgaaattat
      901 ctgtcccgtc actttatggt catgtgttga ttccaactat aagcttaaag ccacgctgag
      961 ggtcaataat cggatcagta caaccacccc caaaaaatcc ctaccggaat ccatcaaatc
     1021 caatttccaa aacttaatcc ttgcagacag caatttctac aaatcctctg ctatagacat
     1081 tgtagtgggg gttgacattt attctcgtat tgttcttgat ggcatctaca taaaaactgg
     1141 tcttccgaca gcccagaata ctgcatttgg aatgattttg tatggtacat tttcacctta
     1201 a