Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367127 1201 bp mRNA linear INV 02-SEP-2023 (LOC106088932), mRNA. ACCESSION XM_059367127 VERSION XM_059367127.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1201 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1201 /gene="LOC106088932" /note="uncharacterized LOC106088932; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088932" CDS 299..1201 /gene="LOC106088932" /codon_start=1 /product="uncharacterized protein LOC106088932" /protein_id="XP_059223110.1" /db_xref="GeneID:106088932" /translation="MNSIEKSKLQRGKTTFVCRLCRRPHGLRVCKRFQNLNVSERLAA VKKYGYCTNCLAHSHSQGSCFTRTGCTHCHEKHHSLLHVNSRLRKSLSSSSTKTDQRK MSRHSSIGIQPTTATRREKTDTKESCEKDSLPSISMSLSSILQQNAATLLPTAIVKIQ TKEGKRLARCLLDTASRMSWISKKFADKLNLTTLELDNEIICPVTLWSCVDSNYKLKA TLRVNNRISTTTPKKSLPESIKSNFQNLILADSNFYKSSAIDIVVGVDIYSRIVLDGI YIKTGLPTAQNTAFGMILYGTFSP" ORIGIN 1 atttgtcgca tcgttattgt caaaatcgat taaatacatt attgagctac cattatacga 61 agacataatt cataactaaa aggatctgat tggaaacaca atattatctg caccaacaaa 121 gtgaaaagga agcgcataat ccctgttcat caaatttaca ttttcctacg tttaagcgga 181 taaagtgtgg attttaagcc gtagccaaaa aagccgaata taccgacaac gaggcattaa 241 tttgggaacc caggtacttt catggactct ttactgtgag ttgggtttgc taagcagtat 301 gaactccatt gaaaaatcaa agctacagag gggcaaaaca acatttgttt gcagattatg 361 tcgaaggcct catggactta gggtctgtaa gagatttcaa aacttgaacg tatcggaaag 421 attggcagct gtgaagaaat atgggtattg tacaaattgc ctcgcccatt cccactctca 481 ggggtcctgt ttcacaagga cgggctgtac acattgccat gaaaaacatc attcactcct 541 tcatgtgaat tcacgacttc gtaaaagttt gtcttcttct tctactaaaa cggatcaacg 601 gaaaatgtct agacactcat ctattggaat tcaaccaaca acggccacgc ggagggaaaa 661 aaccgatacg aaagagtcct gtgaaaagga cagtttgcct tcaatttcca tgtctctcag 721 ttcaattctt caacaaaatg cagcaacttt gcttcctaca gctattgtaa aaattcagac 781 aaaagaagga aaacgtctag cccgatgttt gctggacacg gcctcccgca tgagttggat 841 ttccaaaaag tttgcagaca agctaaattt aacaacccta gagctggaca atgaaattat 901 ctgtcccgtc actttatggt catgtgttga ttccaactat aagcttaaag ccacgctgag 961 ggtcaataat cggatcagta caaccacccc caaaaaatcc ctaccggaat ccatcaaatc 1021 caatttccaa aacttaatcc ttgcagacag caatttctac aaatcctctg ctatagacat 1081 tgtagtgggg gttgacattt attctcgtat tgttcttgat ggcatctaca taaaaactgg 1141 tcttccgaca gcccagaata ctgcatttgg aatgattttg tatggtacat tttcacctta 1201 a