Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996927


LOCUS       XM_059367126             924 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996927), mRNA.
ACCESSION   XM_059367126
VERSION     XM_059367126.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..924
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..924
                     /gene="LOC131996927"
                     /note="uncharacterized LOC131996927; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996927"
     CDS             1..924
                     /gene="LOC131996927"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996927"
                     /protein_id="XP_059223109.1"
                     /db_xref="GeneID:131996927"
                     /translation="MFDEIRYEINGVEIDRTRYLGISSTLKNYISINSIENNMMLNAG
                     WSKETDLNKQKFNFYVPLNKLLGFSEDFTKVVLNCKHDLILLRSSTDLNACYSTTQTE
                     KVKINITNITWRIPHVHISDETKLKIMKTIKDGKTIPITFRSWDCHFNPTFPGAVKCN
                     WNVKLSVNRERPRFLVFAFENNKKFIHCNLTNFKVHLNSDIYPYDDLNIKFDDNRYAV
                     LYDMYARFQQSFYLKEPQPILSCDEFKETPITVIDVSHQNETIKAGPIDVKIEFETSQ
                     SIPENTSAYCLIIHDRFIEYTPLTGTVRKII"
ORIGIN      
        1 atgtttgatg aaattcgcta tgaaattaat ggtgtagaaa tagatagaac acgatatttg
       61 ggcatttcaa gtactttaaa aaactacatt tcaataaata gtattgaaaa taatatgatg
      121 ctgaatgctg gctggagcaa agaaaccgat ttgaacaagc agaagttcaa tttttatgtg
      181 ccactaaata agttattggg attttctgag gatttcacga aagttgtttt aaattgtaaa
      241 catgacctta tactcctacg aagttccact gatttgaatg cctgctattc aactacccaa
      301 acggaaaaag ttaaaattaa tataacgaat ataacatgga gaattcccca tgttcatatc
      361 tcagatgaaa cgaagctaaa aataatgaaa acaattaaag atggaaagac tataccaatc
      421 acgtttcgta gctgggattg tcattttaat cctacatttc ccggtgcagt caagtgcaat
      481 tggaacgtta aactttctgt aaatagggag agaccacgtt ttttagtatt tgcatttgaa
      541 aataacaaaa aatttatcca ttgtaactta acaaatttca aagtacattt aaattcagat
      601 atttacccat acgatgacct taatataaaa tttgatgata atcgttatgc agttctttat
      661 gatatgtatg caagatttca acaaagcttt tatttgaagg aaccgcaacc tatcctgtca
      721 tgtgatgaat tcaaagaaac ccctataact gtaattgatg ttagtcatca aaatgagaca
      781 ataaaagccg ggcctattga tgttaaaatt gaattcgaaa ccagccaatc cattcctgaa
      841 aatacgtcgg catattgttt aataatacac gatcgtttca tcgaatacac acctttgact
      901 ggaactgttc gaaaaatcat ttaa