Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367125 819 bp mRNA linear INV 02-SEP-2023 (LOC131996926), mRNA. ACCESSION XM_059367125 VERSION XM_059367125.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..819 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..819 /gene="LOC131996926" /note="uncharacterized LOC131996926; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996926" CDS 1..819 /gene="LOC131996926" /codon_start=1 /product="uncharacterized protein LOC131996926" /protein_id="XP_059223108.1" /db_xref="GeneID:131996926" /translation="MNLERTPPPAGASASDPPVDSSVVEPSACQVCHITMTEGLECLI LNECSHPFHRQCIEEYLSNASECPVCKKPCQLSELRVLKIVHRSVPPFKGSQRGKGRG AMPRHYQTRSTTREFQDTQYQQLNRSLDFPSTPDRSNLQTNPSRGISPARGLSQPAAV HSVQIHAASAHTAPMQSAPIHTAPVLVDYSRIDQLIETNLSRMLQNMNFAPPANANRN IPSSQRPLNNLSQTMNNVSDENIRSHQLSKVGILNLTGLRMDLVWRNFCTGLFL" ORIGIN 1 atgaacttgg aacgaacacc acctccggca ggtgcgtctg catctgatcc tcctgtagat 61 tcatctgtgg tggaaccttc cgcatgtcag gtttgtcaca tcactatgac cgaaggactg 121 gaatgtttga ttttgaatga atgttcgcat ccatttcata gacagtgcat agaggaatat 181 ttgtcaaatg cgtcagagtg tcccgtttgt aagaaaccct gtcaacttag cgagttgaga 241 gttttgaaga ttgtccacag atctgtgccg ccatttaagg gcagtcagag gggcaagggc 301 agaggcgcaa tgccaaggca ttatcagact cgtagtacga cgcgtgaatt tcaggataca 361 cagtatcagc agttgaatcg tagtttggat tttccgagta cacctgatcg aagtaattta 421 cagaccaatc caagtcgggg aatttctccc gctcgtggtt tatctcaacc tgcggcagtt 481 cattctgttc aaattcatgc tgcttcagct catacggctc caatgcaatc tgctccgatt 541 catactgcac cagtattggt ggattatagt agaattgacc aattgatcga gacaaatttg 601 agtaggatgc ttcaaaatat gaactttgca cctcctgcta atgcaaatcg taatatccct 661 tcttctcaaa ggcctctgaa taatttgagt cagactatga acaatgtcag tgacgagaat 721 ataaggtcac atcaattgtc caaagttgga atattaaatt tgacgggtct gcgaatggac 781 ttggtgtgga ggaatttttg tacaggatta tttctctga