Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996926


LOCUS       XM_059367125             819 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996926), mRNA.
ACCESSION   XM_059367125
VERSION     XM_059367125.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..819
                     /gene="LOC131996926"
                     /note="uncharacterized LOC131996926; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996926"
     CDS             1..819
                     /gene="LOC131996926"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996926"
                     /protein_id="XP_059223108.1"
                     /db_xref="GeneID:131996926"
                     /translation="MNLERTPPPAGASASDPPVDSSVVEPSACQVCHITMTEGLECLI
                     LNECSHPFHRQCIEEYLSNASECPVCKKPCQLSELRVLKIVHRSVPPFKGSQRGKGRG
                     AMPRHYQTRSTTREFQDTQYQQLNRSLDFPSTPDRSNLQTNPSRGISPARGLSQPAAV
                     HSVQIHAASAHTAPMQSAPIHTAPVLVDYSRIDQLIETNLSRMLQNMNFAPPANANRN
                     IPSSQRPLNNLSQTMNNVSDENIRSHQLSKVGILNLTGLRMDLVWRNFCTGLFL"
ORIGIN      
        1 atgaacttgg aacgaacacc acctccggca ggtgcgtctg catctgatcc tcctgtagat
       61 tcatctgtgg tggaaccttc cgcatgtcag gtttgtcaca tcactatgac cgaaggactg
      121 gaatgtttga ttttgaatga atgttcgcat ccatttcata gacagtgcat agaggaatat
      181 ttgtcaaatg cgtcagagtg tcccgtttgt aagaaaccct gtcaacttag cgagttgaga
      241 gttttgaaga ttgtccacag atctgtgccg ccatttaagg gcagtcagag gggcaagggc
      301 agaggcgcaa tgccaaggca ttatcagact cgtagtacga cgcgtgaatt tcaggataca
      361 cagtatcagc agttgaatcg tagtttggat tttccgagta cacctgatcg aagtaattta
      421 cagaccaatc caagtcgggg aatttctccc gctcgtggtt tatctcaacc tgcggcagtt
      481 cattctgttc aaattcatgc tgcttcagct catacggctc caatgcaatc tgctccgatt
      541 catactgcac cagtattggt ggattatagt agaattgacc aattgatcga gacaaatttg
      601 agtaggatgc ttcaaaatat gaactttgca cctcctgcta atgcaaatcg taatatccct
      661 tcttctcaaa ggcctctgaa taatttgagt cagactatga acaatgtcag tgacgagaat
      721 ataaggtcac atcaattgtc caaagttgga atattaaatt tgacgggtct gcgaatggac
      781 ttggtgtgga ggaatttttg tacaggatta tttctctga