Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367121 1138 bp mRNA linear INV 02-SEP-2023 4-like (LOC131996921), partial mRNA. ACCESSION XM_059367121 VERSION XM_059367121.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; corrected model. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## internal stop codons :: corrected 5 genomic stop codon ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1138 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene <1..1138 /gene="LOC131996921" /note="NADH-ubiquinone oxidoreductase chain 4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:131996921" CDS <1..927 /gene="LOC131996921" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 5 bases at 5 genomic stop codons" /codon_start=1 /transl_except=(pos:187..189,aa:OTHER) /transl_except=(pos:406..408,aa:OTHER) /transl_except=(pos:544..546,aa:OTHER) /transl_except=(pos:835..837,aa:OTHER) /transl_except=(pos:838..840,aa:OTHER) /product="LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase chain 4-like" /protein_id="XP_059223104.1" /db_xref="GeneID:131996921" /translation="IVALIIIARESVFKYNNYTNLFIFNLILLLVLLVLTFRRINLFI FYLFFERRLIPTLFLILGXGYQPERLQAGVYLLFYTLLVSLPILIGIFYLYKIANTIN FYLLNNFIFNYEILYFSLVIAFLVKIPIFLVHLXLPKAHVEAPVSGSIILAGIILKLG GYGLLRVFPFLQILGLKFNYIXIRIRLVGGVLVSLTCLCQTDLKALIAYSSVAHIGIV LAGLITLTYIGICGSYTLMIAHGLCSSGLFCLANITYERIGSRSLLINKGLLNFMPSI RLXXFLLSSANIAAPPTLNLLGEISLINRIVR" polyA_site 1138 /gene="LOC131996921" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgtagcat taataataat agcaagagaa tcagttttta aatataataa ttatactaat 61 ttatttatat ttaatttgat tttattatta gttttattag tattaacttt tagaagaata 121 aatttattta tattttattt attttttgaa agaagattaa ttcctacatt atttttaatt 181 ttaggttgag gatatcaacc tgaacgttta caagcaggtg tatatttact attttacact 241 ttattagttt ctttaccaat attaattgga attttttatt tgtacaaaat agcaaataca 301 ataaattttt atttattaaa taatttcata tttaattatg aaattttata tttttcttta 361 gttatagcat ttttagtaaa aataccaata tttttagtac atttatgatt accaaaagct 421 catgttgaag ctccagtatc tggttcaata attttagcag gaattatatt aaaattagga 481 ggttatggtt tattacgtgt atttcctttt ttacaaatat taggtttaaa atttaattat 541 atttgaatta gaattagatt agtaggagga gtattagtaa gtttaacttg tttatgtcag 601 actgatttaa aggctttgat tgcttattca tcagttgctc atataggaat tgttttagca 661 ggattaataa ctttaacata tataggaatt tgtggttctt atactttaat gattgctcat 721 gggttatgtt cttctggatt attttgttta gctaatatta catacgaacg aataggaagt 781 cgaagtttat taatcaataa gggtttatta aattttatgc cttcaataag attatgatga 841 tttttattaa gttcagcaaa tatagctgct cctcctacat taaatttatt aggagaaatt 901 tctttaatta atagaattgt tagatgatca tgattaacta tattaatatt atctctttta 961 tcttttttta gagctgctta tactttgtat ttatatgctt atagacaaca tggaaaggtt 1021 ttttctggag tttactcttt tagaggagga aaagttcgag agtatttact tttattttta 1081 cattgatttc ctttaaatct attaatttta aagagagata tatgtatatt atgattat