Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NADH-ubiquinone oxidoreductase chain


LOCUS       XM_059367121            1138 bp    mRNA    linear   INV 02-SEP-2023
            4-like (LOC131996921), partial mRNA.
ACCESSION   XM_059367121
VERSION     XM_059367121.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            internal stop codons :: corrected 5 genomic stop codon
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1138
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..1138
                     /gene="LOC131996921"
                     /note="NADH-ubiquinone oxidoreductase chain 4-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:131996921"
     CDS             <1..927
                     /gene="LOC131996921"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 5 bases at 5
                     genomic stop codons"
                     /codon_start=1
                     /transl_except=(pos:187..189,aa:OTHER)
                     /transl_except=(pos:406..408,aa:OTHER)
                     /transl_except=(pos:544..546,aa:OTHER)
                     /transl_except=(pos:835..837,aa:OTHER)
                     /transl_except=(pos:838..840,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: NADH-ubiquinone
                     oxidoreductase chain 4-like"
                     /protein_id="XP_059223104.1"
                     /db_xref="GeneID:131996921"
                     /translation="IVALIIIARESVFKYNNYTNLFIFNLILLLVLLVLTFRRINLFI
                     FYLFFERRLIPTLFLILGXGYQPERLQAGVYLLFYTLLVSLPILIGIFYLYKIANTIN
                     FYLLNNFIFNYEILYFSLVIAFLVKIPIFLVHLXLPKAHVEAPVSGSIILAGIILKLG
                     GYGLLRVFPFLQILGLKFNYIXIRIRLVGGVLVSLTCLCQTDLKALIAYSSVAHIGIV
                     LAGLITLTYIGICGSYTLMIAHGLCSSGLFCLANITYERIGSRSLLINKGLLNFMPSI
                     RLXXFLLSSANIAAPPTLNLLGEISLINRIVR"
     polyA_site      1138
                     /gene="LOC131996921"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgtagcat taataataat agcaagagaa tcagttttta aatataataa ttatactaat
       61 ttatttatat ttaatttgat tttattatta gttttattag tattaacttt tagaagaata
      121 aatttattta tattttattt attttttgaa agaagattaa ttcctacatt atttttaatt
      181 ttaggttgag gatatcaacc tgaacgttta caagcaggtg tatatttact attttacact
      241 ttattagttt ctttaccaat attaattgga attttttatt tgtacaaaat agcaaataca
      301 ataaattttt atttattaaa taatttcata tttaattatg aaattttata tttttcttta
      361 gttatagcat ttttagtaaa aataccaata tttttagtac atttatgatt accaaaagct
      421 catgttgaag ctccagtatc tggttcaata attttagcag gaattatatt aaaattagga
      481 ggttatggtt tattacgtgt atttcctttt ttacaaatat taggtttaaa atttaattat
      541 atttgaatta gaattagatt agtaggagga gtattagtaa gtttaacttg tttatgtcag
      601 actgatttaa aggctttgat tgcttattca tcagttgctc atataggaat tgttttagca
      661 ggattaataa ctttaacata tataggaatt tgtggttctt atactttaat gattgctcat
      721 gggttatgtt cttctggatt attttgttta gctaatatta catacgaacg aataggaagt
      781 cgaagtttat taatcaataa gggtttatta aattttatgc cttcaataag attatgatga
      841 tttttattaa gttcagcaaa tatagctgct cctcctacat taaatttatt aggagaaatt
      901 tctttaatta atagaattgt tagatgatca tgattaacta tattaatatt atctctttta
      961 tcttttttta gagctgctta tactttgtat ttatatgctt atagacaaca tggaaaggtt
     1021 ttttctggag tttactcttt tagaggagga aaagttcgag agtatttact tttattttta
     1081 cattgatttc ctttaaatct attaatttta aagagagata tatgtatatt atgattat