Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367117 782 bp mRNA linear INV 02-SEP-2023 (LOC131996918), mRNA. ACCESSION XM_059367117 VERSION XM_059367117.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 13% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..782 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..782 /gene="LOC131996918" /note="uncharacterized LOC131996918; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996918" CDS 42..782 /gene="LOC131996918" /codon_start=1 /product="uncharacterized protein LOC131996918" /protein_id="XP_059223100.1" /db_xref="GeneID:131996918" /translation="MEKKIVKKSTPQQLQELVKAMMEDSDLAKGIPVFGGSKYTVDEK WKTITTKLNMHGPPMRTTAEWRKTWADLKSRTKKKLMDNKKSLEATGGGEYAFCALTE LEEMVDRAISATRSAVPTGAKYGFCSQQPIMVEEDIVECFTPYVASPPRSNKDVAVNT PKRNGVPDCSKKNYQVVPTNYSLHTSGMATTITDTTAPSSTPAATTVPYSTARPSTAP FTNKEALYHVVGIQHHQQYEADGLEEDT" ORIGIN 1 ctcacttgca ttttagcctt cgcgcgctaa attattaaaa aatggaaaag aaaatcgtaa 61 aaaaatctac accccagcag ctacaagagc tggtcaaagc catgatggag gattcggatt 121 tggccaaggg tattccagta tttggagggt ccaaatatac agtggatgag aagtggaaaa 181 ccattaccac aaaattaaac atgcatggcc ctcctatgcg taccacagcc gagtggagaa 241 agacttgggc ggacttaaaa tcgcgcacca aaaagaaact gatggataat aaaaagagct 301 tggaagctac aggtggtggc gaatatgctt tctgtgccct aacagaattg gaggagatgg 361 tagaccgtgc tatatcagcc actagatctg cggttccgac cggtgctaag tacggctttt 421 gttctcaaca acccataatg gttgaagaag acattgtaga gtgcttcaca ccttatgtag 481 cgtcaccgcc gcgtagcaac aaagatgtgg ctgtaaatac gccaaaaaga aacggggtac 541 ctgattgtag taaaaaaaat tatcaggttg tgcccacaaa ctacagttta cacacaagcg 601 gaatggctac cactattaca gataccaccg ccccatctag cacccccgca gctaccaccg 661 tcccatatag caccgcacga cctagtaccg ccccattcac taacaaagaa gcactgtacc 721 atgtggtagg tatacaacat catcaacaat atgaggcaga tggcttggag gaggacacct 781 aa