Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996918


LOCUS       XM_059367117             782 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996918), mRNA.
ACCESSION   XM_059367117
VERSION     XM_059367117.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 13% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..782
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..782
                     /gene="LOC131996918"
                     /note="uncharacterized LOC131996918; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996918"
     CDS             42..782
                     /gene="LOC131996918"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996918"
                     /protein_id="XP_059223100.1"
                     /db_xref="GeneID:131996918"
                     /translation="MEKKIVKKSTPQQLQELVKAMMEDSDLAKGIPVFGGSKYTVDEK
                     WKTITTKLNMHGPPMRTTAEWRKTWADLKSRTKKKLMDNKKSLEATGGGEYAFCALTE
                     LEEMVDRAISATRSAVPTGAKYGFCSQQPIMVEEDIVECFTPYVASPPRSNKDVAVNT
                     PKRNGVPDCSKKNYQVVPTNYSLHTSGMATTITDTTAPSSTPAATTVPYSTARPSTAP
                     FTNKEALYHVVGIQHHQQYEADGLEEDT"
ORIGIN      
        1 ctcacttgca ttttagcctt cgcgcgctaa attattaaaa aatggaaaag aaaatcgtaa
       61 aaaaatctac accccagcag ctacaagagc tggtcaaagc catgatggag gattcggatt
      121 tggccaaggg tattccagta tttggagggt ccaaatatac agtggatgag aagtggaaaa
      181 ccattaccac aaaattaaac atgcatggcc ctcctatgcg taccacagcc gagtggagaa
      241 agacttgggc ggacttaaaa tcgcgcacca aaaagaaact gatggataat aaaaagagct
      301 tggaagctac aggtggtggc gaatatgctt tctgtgccct aacagaattg gaggagatgg
      361 tagaccgtgc tatatcagcc actagatctg cggttccgac cggtgctaag tacggctttt
      421 gttctcaaca acccataatg gttgaagaag acattgtaga gtgcttcaca ccttatgtag
      481 cgtcaccgcc gcgtagcaac aaagatgtgg ctgtaaatac gccaaaaaga aacggggtac
      541 ctgattgtag taaaaaaaat tatcaggttg tgcccacaaa ctacagttta cacacaagcg
      601 gaatggctac cactattaca gataccaccg ccccatctag cacccccgca gctaccaccg
      661 tcccatatag caccgcacga cctagtaccg ccccattcac taacaaagaa gcactgtacc
      721 atgtggtagg tatacaacat catcaacaat atgaggcaga tggcttggag gaggacacct
      781 aa