Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367116 1167 bp mRNA linear INV 02-SEP-2023 (LOC131993974), mRNA. ACCESSION XM_059367116 VERSION XM_059367116.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1167 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1167 /gene="LOC131993974" /note="transcription factor grauzone-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131993974" CDS 1..1167 /gene="LOC131993974" /codon_start=1 /product="transcription factor grauzone-like" /protein_id="XP_059223099.1" /db_xref="GeneID:131993974" /translation="MPGCHACRLCRSSCIDSLRLYNASGSCNEIYNITKKFFHIKYLD HGPKDSTAVLCMECWRNISDFNSFQQTVTILHDNLVNDEVQTVNEPNISRVQEPADGI EIPDALDEFMEETDRLEVPSTAGFGSGQLIVTDSGIQFLSQTAPATDIIPVVSGGLQY VENAEAQVQQAIVIDDEPSGSDEDVFVVNELDQWEHQSVNSISSTEDSNDQLTVLRKR SRTSENPSPALTSQYSKSMAEGNAILAEWRPFLDCYVCRKKFPDFAAIKQHFKMEHYS NDFFIECCGRKIKYRFRLVEHALIHVNPKAFQCQYCQKCLANKNSLLSHKHFLHFDQL TDDEKKQISSVHISICPVCGKSFTYRTGLHAHMRSIHFEEYYKRKASTSITNVP" ORIGIN 1 atgccgggat gccatgcgtg tcgattatgc aggagtagtt gcatcgacag cctacgccta 61 tacaacgcca gtggcagttg caatgagatt tataacatca caaaaaaatt tttccacatc 121 aagtatctgg accatggacc caaagattcg acggcagttt tgtgcatgga gtgttggcgc 181 aatatatccg atttcaacag tttccaacag acggtgacta ttttacacga taaccttgtc 241 aatgacgagg tgcaaactgt gaatgagcca aatatttcgc gagtccagga gccagcggat 301 ggaattgaaa tacctgatgc tttggatgaa tttatggaag aaacagaccg acttgaagta 361 ccttctacgg ctggttttgg ctcgggacaa cttattgtta cagatagtgg gatacaattt 421 ttaagtcaaa ccgcacctgc cacagatatt attccggtgg tatccggagg tttacagtat 481 gttgaaaatg cagaggctca ggtgcagcaa gcaattgtga tagatgacga acccagcggc 541 agtgacgaag atgtcttcgt tgttaatgaa ctggaccagt gggagcatca gtcagttaat 601 tccatatcaa gtacagaaga ttcaaatgat caattgactg tattaagaaa acgatcccga 661 acttcagaaa acccctcacc agctttaacc tcacaatact caaagtcaat ggctgaaggt 721 aatgccattt tagctgagtg gagacctttc ttagattgct atgtctgccg gaaaaaattc 781 ccagatttcg ccgccattaa acagcatttc aaaatggaac attactccaa tgacttcttc 841 atagaatgct gcgggcggaa gatcaaatat cgatttcgtc ttgtagaaca tgccttgatc 901 cacgtcaatc ccaaagcatt tcagtgtcaa tattgccaaa agtgtttggc aaacaaaaat 961 tcgttgttaa gtcataagca ttttctacat ttcgaccaac tcactgatga cgaaaagaaa 1021 caaataagca gtgtacacat cagcatttgt ccagtttgtg gcaaatcatt tacatatcgc 1081 acaggactcc atgcccacat gaggtcaatt cattttgaag aatattacaa aagaaaagca 1141 agtacaagta taacaaatgt gccctaa