Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription factor grauzone-like


LOCUS       XM_059367116            1167 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131993974), mRNA.
ACCESSION   XM_059367116
VERSION     XM_059367116.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1167
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1167
                     /gene="LOC131993974"
                     /note="transcription factor grauzone-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:131993974"
     CDS             1..1167
                     /gene="LOC131993974"
                     /codon_start=1
                     /product="transcription factor grauzone-like"
                     /protein_id="XP_059223099.1"
                     /db_xref="GeneID:131993974"
                     /translation="MPGCHACRLCRSSCIDSLRLYNASGSCNEIYNITKKFFHIKYLD
                     HGPKDSTAVLCMECWRNISDFNSFQQTVTILHDNLVNDEVQTVNEPNISRVQEPADGI
                     EIPDALDEFMEETDRLEVPSTAGFGSGQLIVTDSGIQFLSQTAPATDIIPVVSGGLQY
                     VENAEAQVQQAIVIDDEPSGSDEDVFVVNELDQWEHQSVNSISSTEDSNDQLTVLRKR
                     SRTSENPSPALTSQYSKSMAEGNAILAEWRPFLDCYVCRKKFPDFAAIKQHFKMEHYS
                     NDFFIECCGRKIKYRFRLVEHALIHVNPKAFQCQYCQKCLANKNSLLSHKHFLHFDQL
                     TDDEKKQISSVHISICPVCGKSFTYRTGLHAHMRSIHFEEYYKRKASTSITNVP"
ORIGIN      
        1 atgccgggat gccatgcgtg tcgattatgc aggagtagtt gcatcgacag cctacgccta
       61 tacaacgcca gtggcagttg caatgagatt tataacatca caaaaaaatt tttccacatc
      121 aagtatctgg accatggacc caaagattcg acggcagttt tgtgcatgga gtgttggcgc
      181 aatatatccg atttcaacag tttccaacag acggtgacta ttttacacga taaccttgtc
      241 aatgacgagg tgcaaactgt gaatgagcca aatatttcgc gagtccagga gccagcggat
      301 ggaattgaaa tacctgatgc tttggatgaa tttatggaag aaacagaccg acttgaagta
      361 ccttctacgg ctggttttgg ctcgggacaa cttattgtta cagatagtgg gatacaattt
      421 ttaagtcaaa ccgcacctgc cacagatatt attccggtgg tatccggagg tttacagtat
      481 gttgaaaatg cagaggctca ggtgcagcaa gcaattgtga tagatgacga acccagcggc
      541 agtgacgaag atgtcttcgt tgttaatgaa ctggaccagt gggagcatca gtcagttaat
      601 tccatatcaa gtacagaaga ttcaaatgat caattgactg tattaagaaa acgatcccga
      661 acttcagaaa acccctcacc agctttaacc tcacaatact caaagtcaat ggctgaaggt
      721 aatgccattt tagctgagtg gagacctttc ttagattgct atgtctgccg gaaaaaattc
      781 ccagatttcg ccgccattaa acagcatttc aaaatggaac attactccaa tgacttcttc
      841 atagaatgct gcgggcggaa gatcaaatat cgatttcgtc ttgtagaaca tgccttgatc
      901 cacgtcaatc ccaaagcatt tcagtgtcaa tattgccaaa agtgtttggc aaacaaaaat
      961 tcgttgttaa gtcataagca ttttctacat ttcgaccaac tcactgatga cgaaaagaaa
     1021 caaataagca gtgtacacat cagcatttgt ccagtttgtg gcaaatcatt tacatatcgc
     1081 acaggactcc atgcccacat gaggtcaatt cattttgaag aatattacaa aagaaaagca
     1141 agtacaagta taacaaatgt gccctaa