PREDICTED: Stomoxys calcitrans uncharacterized LOC131996910

LOCUS       XM_059367109             759 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996910), mRNA.
ACCESSION   XM_059367109
VERSION     XM_059367109.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..759
                     /gene="LOC131996910"
                     /note="uncharacterized LOC131996910; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996910"
     CDS             1..759
                     /gene="LOC131996910"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996910"
                     /protein_id="XP_059223092.1"
                     /db_xref="GeneID:131996910"
                     /translation="MSTSEGSSSTSMEISRVAIKAPPFWHADPLLWFKQMESQFLMAG
                     VTQDSTKFHTIVASIESSILEKVHDIVINPPAVNMYGTLKDKLVSCFSDSEEKRLKKL
                     LTTIELGDKKPSELLSGMRSLAQGKVSDEILKQLWIQRLPSQMKAILSVSDDNLDKLA
                     TMADKISDCADSEVCAVTPSNSRLEDIERKLENLCAKMDSFGKSRSRSKSKTGKRSRS
                     KSSKRDKSLCWYHFKFGDKAKKCVSPCNYNASEN"
ORIGIN      
        1 atgtcgacgt cagaaggcag ttcttcaaca tcaatggaaa tttctcgcgt agcgattaaa
       61 gccccaccat tttggcatgc ggatcccttg ctctggttta aacaaatgga atcgcaattt
      121 ttaatggcag gcgtaacgca agattccacg aaattccata cgattgtcgc atcaattgag
      181 agcagcatcc ttgaaaaggt tcatgacatc gtaatcaatc ccccagctgt gaatatgtat
      241 ggaacattaa aggacaaatt ggtgagctgt ttttccgatt ccgaagaaaa acgtttgaaa
      301 aaactcctga caacaatcga acttggagac aagaagccat ccgaattatt gagcgggatg
      361 cgaagtttgg ctcaaggtaa ggtatcggac gagattttaa agcaactttg gatacagcgt
      421 cttcccagtc agatgaaagc aattctttcc gtcagcgatg acaacttgga taagcttgcc
      481 acaatggccg acaaaatttc cgattgcgcc gattcagaag tgtgtgcggt tactccttcc
      541 aacagccgtc ttgaggatat agagagaaag ctagagaatc tctgtgcaaa gatggattca
      601 tttggaaaat caagaagccg cagcaaatca aagactggaa aacgaagtcg atccaaatca
      661 tcgaagagag acaaatcgct ttgctggtac cattttaagt tcggggacaa agcgaaaaag
      721 tgtgtgtctc cgtgcaatta caacgcttcg gaaaactaa