PREDICTED: Stomoxys calcitrans FUN14 domain-containing protein

LOCUS       XM_059367108             330 bp    mRNA    linear   INV 02-SEP-2023
            1-like (LOC131996909), mRNA.
ACCESSION   XM_059367108
VERSION     XM_059367108.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..330
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..330
                     /gene="LOC131996909"
                     /note="FUN14 domain-containing protein 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 20 Proteins"
                     /db_xref="GeneID:131996909"
     CDS             1..330
                     /gene="LOC131996909"
                     /codon_start=1
                     /product="FUN14 domain-containing protein 1-like"
                     /protein_id="XP_059223091.1"
                     /db_xref="GeneID:131996909"
                     /translation="MNLNSFKQKGPYTEIGIGATVGLFTGFITMRIGKLAAIAVGSSI
                     LILEIAQMEGLIKFDWSAIPKLLDMGKQQMSNKSSIIEQALDFAITNMAFTTSFIGGV
                     FIGIGLS"
ORIGIN      
        1 atgaatctaa attcgttcaa gcaaaaagga ccctacactg aaatcggcat aggtgcaaca
       61 gtgggtttat ttactggttt catcaccatg agaataggaa aattggctgc aattgctgtg
      121 ggcagcagta tactaatact ggaaatcgca cagatggaag gtctgataaa attcgattgg
      181 tccgctattc caaaactatt ggacatggga aaacaacaaa tgtctaataa atcatcaata
      241 atcgaacaag cattggattt cgcaataaca aatatggcct tcacgacatc ctttatagga
      301 ggtgtgttta ttggaattgg attatcctaa