PREDICTED: Stomoxys calcitrans uncharacterized LOC131996906

LOCUS       XM_059367105             495 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996906), mRNA.
ACCESSION   XM_059367105
VERSION     XM_059367105.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..495
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..495
                     /gene="LOC131996906"
                     /note="uncharacterized LOC131996906; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:131996906"
     CDS             1..495
                     /gene="LOC131996906"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996906"
                     /protein_id="XP_059223088.1"
                     /db_xref="GeneID:131996906"
                     /translation="MLGLRSSINHDLSVSPAASVYGMELTLPGEFFTESKFSKLRSDW
                     VAQFKADMNNVKAKKLNRHGDSNIYEPNALEEAEFVFIRNDAVRASLQPPYTGPFPVL
                     SRGAKTFVVDVNGKRKTISVDRLKPALILKDEMPTKSISPQQVPNDSHSRTLRSGKTV
                     RIKT"
ORIGIN      
        1 atgttgggat tacgttcatc tatcaatcat gatttaagcg tatcgcctgc tgcgtcagta
       61 tatggtatgg agcttacatt accaggtgaa ttctttactg aatcgaaatt tagtaaattg
      121 cgttctgatt gggttgcaca atttaaagct gatatgaaca acgtcaaagc aaagaagctt
      181 aaccgtcatg gcgattcaaa tatttatgag ccaaatgcat tggaagaagc agaatttgta
      241 ttcatccgaa acgacgctgt gcgagcttca ttacaacctc catacacagg accttttcct
      301 gttctatcta gaggagcaaa aacatttgta gttgatgtta atggaaaacg gaagacgata
      361 tctgttgatc gccttaagcc agccttaatc ttgaaagacg aaatgccaac gaaatccata
      421 tcacctcaac aagtaccaaa tgattctcat tcacgaactc tacgatcagg aaaaactgtg
      481 agaattaaaa cttaa