PREDICTED: Stomoxys calcitrans uncharacterized LOC131996903

LOCUS       XM_059367099             677 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996903), mRNA.
ACCESSION   XM_059367099
VERSION     XM_059367099.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..677
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..677
                     /gene="LOC131996903"
                     /note="uncharacterized LOC131996903; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996903"
     CDS             42..677
                     /gene="LOC131996903"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996903"
                     /protein_id="XP_059223082.1"
                     /db_xref="GeneID:131996903"
                     /translation="MSSLNSISSSMHTLSPTYSTPTAAHILHTTFRGSTSSTKSKFTG
                     SHHTSTPTVGLSSSALPSFKNFMKSPNSHSTATNGGKQEFPLDFTFSKNHWTNSDAAF
                     TGGGRGAGGVGDTMANMLGSVGVPAVAAAATSGSGNFRLGASSTSSFSTETERPRVFR
                     NRHHHEQHWGPFFEQPLNSTTSGDNSITTAHLYTEAVLNCRVGMLKDKTFS"
ORIGIN      
        1 caacatcagc tggatttcat aatttaaaga catccagaat tatgagcagc ctgaacagca
       61 tcagcagcag catgcatacc ctcagtccaa cctacagtac gcccacagca gcccatatac
      121 tgcacaccac ctttcgaggc agcaccagca gcactaaatc gaaatttacg ggctctcacc
      181 acaccagcac cccaactgtg ggacttagct ccagtgcatt gccttcattc aagaatttta
      241 tgaagagtcc aaatagccac agcactgcaa caaatggcgg caagcaggag tttccacttg
      301 attttacatt ctccaagaac cattggacca actcagatgc tgccttcact ggtgggggca
      361 gaggtgctgg tggtgttggt gataccatgg ccaatatgtt gggaagtgtt ggtgttcctg
      421 ctgtggccgc agcggccacc agtggtagtg gcaattttag acttggcgcc tcatcaacgt
      481 cttcattttc cacagaaaca gagcggccac gcgtttttcg caaccgacat catcacgaac
      541 aacactgggg gccatttttc gagcaaccac tcaactcaac aacctcgggc gacaatagca
      601 taacaacagc ccatctctat acggaagcag tgctcaattg tcgtgttggc atgctcaaag
      661 acaaaacgtt cagttaa