Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367091 960 bp mRNA linear INV 02-SEP-2023 (LOC131996897), mRNA. ACCESSION XM_059367091 VERSION XM_059367091.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..960 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..960 /gene="LOC131996897" /note="uncharacterized LOC131996897; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131996897" CDS 1..960 /gene="LOC131996897" /codon_start=1 /product="uncharacterized protein LOC131996897" /protein_id="XP_059223074.1" /db_xref="GeneID:131996897" /translation="MAPLPQDRCTITPAFHVTGIDFAGPFDIKSSPLRRSPLLKGYVS IFVCFATKAVHLEPCSELSTAAFEAAFARFLGRRGLPRKVVSDNGRNFVGASRKLLRE FRSFIQTSASDISERYSTQGFEWQFIPPHAPHMGGLWESAVKSFKHHFRRVAGAHLFT FEQFATVLARIEGVLNSRPISAVSEDPNDLTALTPGHFLKGSPIMAFPEPTPQDVSLL NRWLKLKAIHHQFAIRWKEDYLKALQKRYKWRTTSPNMKIGDLVVVIDDLLPPSDWRL GRVVKTHAGSDKNTRIADVKIASGVITRPIVKLCLLPLLDQPQ" ORIGIN 1 atggcaccgc tccctcaaga tagatgtacg ataactccgg catttcacgt cactggcata 61 gactttgcag gaccttttga tattaaaagt tctccactac gccgttcccc tctcttaaag 121 ggctatgtca gcatctttgt atgcttcgcc acgaaagccg tacatctgga accatgctcg 181 gaactttcca cggcggcatt tgaggccgct tttgcccgtt ttcttgggag acgaggccta 241 cctcggaagg tagtttcgga taatggtagg aatttcgttg gtgccagtcg caagctgcta 301 cgggaattta gaagcttcat ccaaacatca gcaagcgaca tatcggaaag atattcgaca 361 cagggctttg aatggcagtt tataccaccc cacgcccctc atatgggagg actctgggag 421 tcggctgtca agagtttcaa acaccacttt agaagagtag ctggggctca tttgttcacc 481 ttcgaacagt ttgccaccgt gcttgcccgg atcgagggtg tcttgaactc acgtccaatt 541 tccgctgtct ctgaggatcc gaacgacctc acagcgttga ctcccggaca tttcttgaag 601 ggctcgccga tcatggcatt tcccgagcct actcctcagg acgtctccct actaaataga 661 tggttgaaac tcaaggctat ccatcaccaa tttgccatac gatggaagga ggattacctc 721 aaagctcttc aaaaacgcta taaatggaga accacatcac caaatatgaa aatcggcgat 781 ctggtggtcg tcatagacga tttgttgccg cctagtgact ggcgcttggg gagagtagtt 841 aagacgcatg cggggtccga caaaaacacg cgaattgcag atgtgaagat tgcatcagga 901 gtcattactc gaccgatagt aaaattgtgt ctccttccct tattggacca accccaatag