Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996897


LOCUS       XM_059367091             960 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996897), mRNA.
ACCESSION   XM_059367091
VERSION     XM_059367091.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..960
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..960
                     /gene="LOC131996897"
                     /note="uncharacterized LOC131996897; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:131996897"
     CDS             1..960
                     /gene="LOC131996897"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996897"
                     /protein_id="XP_059223074.1"
                     /db_xref="GeneID:131996897"
                     /translation="MAPLPQDRCTITPAFHVTGIDFAGPFDIKSSPLRRSPLLKGYVS
                     IFVCFATKAVHLEPCSELSTAAFEAAFARFLGRRGLPRKVVSDNGRNFVGASRKLLRE
                     FRSFIQTSASDISERYSTQGFEWQFIPPHAPHMGGLWESAVKSFKHHFRRVAGAHLFT
                     FEQFATVLARIEGVLNSRPISAVSEDPNDLTALTPGHFLKGSPIMAFPEPTPQDVSLL
                     NRWLKLKAIHHQFAIRWKEDYLKALQKRYKWRTTSPNMKIGDLVVVIDDLLPPSDWRL
                     GRVVKTHAGSDKNTRIADVKIASGVITRPIVKLCLLPLLDQPQ"
ORIGIN      
        1 atggcaccgc tccctcaaga tagatgtacg ataactccgg catttcacgt cactggcata
       61 gactttgcag gaccttttga tattaaaagt tctccactac gccgttcccc tctcttaaag
      121 ggctatgtca gcatctttgt atgcttcgcc acgaaagccg tacatctgga accatgctcg
      181 gaactttcca cggcggcatt tgaggccgct tttgcccgtt ttcttgggag acgaggccta
      241 cctcggaagg tagtttcgga taatggtagg aatttcgttg gtgccagtcg caagctgcta
      301 cgggaattta gaagcttcat ccaaacatca gcaagcgaca tatcggaaag atattcgaca
      361 cagggctttg aatggcagtt tataccaccc cacgcccctc atatgggagg actctgggag
      421 tcggctgtca agagtttcaa acaccacttt agaagagtag ctggggctca tttgttcacc
      481 ttcgaacagt ttgccaccgt gcttgcccgg atcgagggtg tcttgaactc acgtccaatt
      541 tccgctgtct ctgaggatcc gaacgacctc acagcgttga ctcccggaca tttcttgaag
      601 ggctcgccga tcatggcatt tcccgagcct actcctcagg acgtctccct actaaataga
      661 tggttgaaac tcaaggctat ccatcaccaa tttgccatac gatggaagga ggattacctc
      721 aaagctcttc aaaaacgcta taaatggaga accacatcac caaatatgaa aatcggcgat
      781 ctggtggtcg tcatagacga tttgttgccg cctagtgact ggcgcttggg gagagtagtt
      841 aagacgcatg cggggtccga caaaaacacg cgaattgcag atgtgaagat tgcatcagga
      901 gtcattactc gaccgatagt aaaattgtgt ctccttccct tattggacca accccaatag