Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367088 922 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059367088 VERSION XM_059367088.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 21% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..922 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..922 /gene="LOC106094185" /note="ryncolin-4; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094185" CDS 1..885 /gene="LOC106094185" /codon_start=1 /product="ryncolin-4" /protein_id="XP_059223071.1" /db_xref="GeneID:106094185" /translation="MHIIPLILILCVGLSFGADPTTHSPNLGADDKNVIMKELFETIN PILKEIRKRIDDLTFRLDEQDSLIRSLEAKVSRFDPLAKQSEVPRVRIKQMIEDLEAF NRLDPLTKQQKLLLSDIETNEWKTILRRQDGSVNFYRNWADYKSGFGNPDGEFFIGLE VLHNLTSNGLPQELLVVMQEFDNTERQAKYDLFQVGNETEKYAILQLGEYSGNAEFNA MLYIKGAKFSTFDQDNDTDDTYDCAKNRKSGWWFMDCSYCNLTGPFRKTADTSGEGFL KWYWKNLKFAEMKIRAKK" ORIGIN 1 atgcacatca taccattaat tcttattcta tgtgtgggct tgagttttgg cgccgaccct 61 actactcata gtccaaacct aggcgccgat gataaaaatg ttataatgaa agaactgttt 121 gaaacaataa atccaatctt aaaggagatc agaaagcgca ttgatgattt gacttttagg 181 ttagatgagc aagactcctt gattagaagt ttggaggcaa aagtgagcag atttgatcca 241 cttgccaaac aatcagaggt gcctcgagtt cggattaagc agatgataga agacctagaa 301 gcatttaaca ggcttgatcc acttaccaaa cagcaaaaac tactcttgtc agacattgaa 361 actaacgaat ggaaaaccat acttcgacgc caagatggtt cggtgaattt ctatagaaat 421 tgggctgatt acaaatctgg ttttggcaac cccgatggag aatttttcat tggcctcgaa 481 gtattgcaca atctaaccag taacggctta ccccaagagc tgcttgtggt gatgcaagaa 541 tttgataata cagagagaca agccaaatat gatctctttc aagtgggcaa tgaaacagag 601 aaatatgcca tactccagtt gggcgaatac agcggtaatg cagaatttaa cgctatgtta 661 tatatcaagg gtgcaaaatt ctcaacattt gatcaggata atgataccga tgatacatat 721 gattgtgcta aaaaccgtaa aagtggatgg tggttcatgg attgcagtta ttgcaatttg 781 actggaccct ttaggaaaac agccgataca agtggcgaag gttttttgaa atggtattgg 841 aaaaatctaa aatttgccga aatgaaaatt agagcaaaaa agtgaaaatt gttgtcattg 901 aaaaggaaaa agttttgttt gt