Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ryncolin-4 (LOC106094185), mRNA.


LOCUS       XM_059367088             922 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059367088
VERSION     XM_059367088.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 21% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..922
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..922
                     /gene="LOC106094185"
                     /note="ryncolin-4; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:106094185"
     CDS             1..885
                     /gene="LOC106094185"
                     /codon_start=1
                     /product="ryncolin-4"
                     /protein_id="XP_059223071.1"
                     /db_xref="GeneID:106094185"
                     /translation="MHIIPLILILCVGLSFGADPTTHSPNLGADDKNVIMKELFETIN
                     PILKEIRKRIDDLTFRLDEQDSLIRSLEAKVSRFDPLAKQSEVPRVRIKQMIEDLEAF
                     NRLDPLTKQQKLLLSDIETNEWKTILRRQDGSVNFYRNWADYKSGFGNPDGEFFIGLE
                     VLHNLTSNGLPQELLVVMQEFDNTERQAKYDLFQVGNETEKYAILQLGEYSGNAEFNA
                     MLYIKGAKFSTFDQDNDTDDTYDCAKNRKSGWWFMDCSYCNLTGPFRKTADTSGEGFL
                     KWYWKNLKFAEMKIRAKK"
ORIGIN      
        1 atgcacatca taccattaat tcttattcta tgtgtgggct tgagttttgg cgccgaccct
       61 actactcata gtccaaacct aggcgccgat gataaaaatg ttataatgaa agaactgttt
      121 gaaacaataa atccaatctt aaaggagatc agaaagcgca ttgatgattt gacttttagg
      181 ttagatgagc aagactcctt gattagaagt ttggaggcaa aagtgagcag atttgatcca
      241 cttgccaaac aatcagaggt gcctcgagtt cggattaagc agatgataga agacctagaa
      301 gcatttaaca ggcttgatcc acttaccaaa cagcaaaaac tactcttgtc agacattgaa
      361 actaacgaat ggaaaaccat acttcgacgc caagatggtt cggtgaattt ctatagaaat
      421 tgggctgatt acaaatctgg ttttggcaac cccgatggag aatttttcat tggcctcgaa
      481 gtattgcaca atctaaccag taacggctta ccccaagagc tgcttgtggt gatgcaagaa
      541 tttgataata cagagagaca agccaaatat gatctctttc aagtgggcaa tgaaacagag
      601 aaatatgcca tactccagtt gggcgaatac agcggtaatg cagaatttaa cgctatgtta
      661 tatatcaagg gtgcaaaatt ctcaacattt gatcaggata atgataccga tgatacatat
      721 gattgtgcta aaaaccgtaa aagtggatgg tggttcatgg attgcagtta ttgcaatttg
      781 actggaccct ttaggaaaac agccgataca agtggcgaag gttttttgaa atggtattgg
      841 aaaaatctaa aatttgccga aatgaaaatt agagcaaaaa agtgaaaatt gttgtcattg
      901 aaaaggaaaa agttttgttt gt