Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367087 1143 bp mRNA linear INV 02-SEP-2023 (LOC131996896), mRNA. ACCESSION XM_059367087 VERSION XM_059367087.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1143 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1143 /gene="LOC131996896" /note="uncharacterized LOC131996896; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996896" CDS 1..1143 /gene="LOC131996896" /codon_start=1 /product="uncharacterized protein LOC131996896" /protein_id="XP_059223070.1" /db_xref="GeneID:131996896" /translation="MVRVLSKQKHGISIVHINAQSLNNKMDELRNIFTSSSIDIVCVS ETWFHPELNDFVYNLSDYNLFRADRVSNAGGVCIYIRKELKCSVKIKSETDSEIEYIF LELITKGSKILLGTLYRPNRNIPFNNLLRVIETHSVYYNDVIIAGDFNSNLLVEKKLM ESMNTLGLYSVNTSTPTHFSSAGNTLLDAFFVNCTSKILLYDQLSASTFSKHDLIFIT YDTFVDRAKSQTVYRDFSKIDFHSLWTLENEINWSVVYNLDSVEDQIDYMEYHITNLY NACVPLKSRIVCNNQQPWFSQEIRRLINYRDELYKRWKRFKTHLLYDQFKKARKKVSD SIKTAKNQYYQQKFSTAVDSGSKWKIIRNIGIGQKNKAVVLQFSLT" ORIGIN 1 atggttaggg tgctctcgaa acaaaaacat ggaatttcta ttgtccacat caatgcacaa 61 agccttaaca acaaaatgga cgagcttaga aacatattta cttcctccag catcgatatt 121 gtatgtgtat ccgagacgtg gttccaccca gaacttaatg attttgtata taatctttcg 181 gactacaatc tatttcgagc tgatcgagta tccaatgcag gcggcgtgtg tatatacatt 241 cgtaaggaat taaaatgcag cgtaaaaatc aagtctgaaa ccgatagtga aattgaatat 301 atattcttgg agctgataac aaaaggatct aaaattcttt tgggaacttt ataccgaccc 361 aaccgaaata ttccattcaa taatctatta cgcgtaattg aaacacattc ggtttactac 421 aatgatgtta tcatcgctgg agactttaac agcaatctct tagtcgagaa aaaacttatg 481 gagtctatga atacactggg tctctactca gtaaatacat caacaccaac acatttttcc 541 tctgctggaa acacacttct tgatgctttc tttgtcaact gcacgtctaa aatattacta 601 tacgatcaac tttctgcatc aactttctca aaacatgatc tgattttcat tacttatgac 661 acctttgttg acagagcaaa atctcaaaca gtgtacagag attttagcaa aattgacttc 721 cacagtctct ggacattaga aaatgaaatt aattggagcg tggtctataa tttagactct 781 gtcgaagatc aaatagatta tatggagtac catatcacaa atctttacaa cgcttgtgtt 841 cccttaaaat ctcgaattgt gtgcaacaat caacagccat ggtttagcca agagatcaga 901 cgcctaatta actacagaga tgagctgtac aagagatgga aacgttttaa aacccacttg 961 ctctacgacc agttcaaaaa ggcaagaaaa aaagtttcgg attcaataaa gactgcaaaa 1021 aaccaatatt atcagcaaaa attctctact gcagtcgata gtggatctaa atggaagatc 1081 atacgcaaca tcggaatagg acaaaaaaat aaagcagttg tattacagtt ctcactgact 1141 tag