PREDICTED: Stomoxys calcitrans nuclear pore complex protein

LOCUS       XM_059367085             537 bp    mRNA    linear   INV 02-SEP-2023
            Nup58-like (LOC106090926), mRNA.
ACCESSION   XM_059367085
VERSION     XM_059367085.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 52% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..537
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..537
                     /gene="LOC106090926"
                     /note="nuclear pore complex protein Nup58-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106090926"
     CDS             1..537
                     /gene="LOC106090926"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup58-like"
                     /protein_id="XP_059223068.1"
                     /db_xref="GeneID:106090926"
                     /translation="MRVYQNRTIPFKSFIFALTVLVASASASVGIHGGYIGAASVPVA
                     TYAAPAAYSAYSTYAAPVATYAAPAGVSSYAAPAAVATYGAPTAVSYAAPAAVTAYGA
                     PAAVATYGAPAAVSTYAAPAAVSTYATPAAVATYAAAAPVAVGGYVHSASVPVAQYAA
                     PAATFVRSIGGFGGFFKK"
ORIGIN      
        1 atgagggttt accaaaatcg taccattcct tttaaatcct tcattttcgc tttgacagtc
       61 ttagttgctt ccgcctctgc ttcggttggc attcatggtg gatacattgg tgctgcttct
      121 gttccagttg caacctatgc tgctccagcc gcatactccg catattccac ttatgctgcc
      181 cctgttgcaa cttacgctgc tccagctggt gtttcctcct atgctgcccc agctgccgta
      241 gccacttatg gggctccaac tgcagtttcc tatgccgctc ctgctgctgt tactgcttat
      301 ggtgcccccg ctgcggtagc cacctatggt gcaccagctg ccgtttccac ctatgccgct
      361 ccagctgcag tttccaccta tgccactcca gctgcagtag ccacctacgc tgctgctgcg
      421 cctgtcgctg ttggtggtta tgttcattct gcatcagtac cagttgcgca atatgctgcc
      481 cctgctgcaa cttttgttcg ctcaatagga ggctttggag gtttcttcaa gaagtaa