Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367082 726 bp mRNA linear INV 02-SEP-2023 (LOC106090929), mRNA. ACCESSION XM_059367082 VERSION XM_059367082.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..726 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..726 /gene="LOC106090929" /note="uncharacterized LOC106090929; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106090929" CDS 1..726 /gene="LOC106090929" /codon_start=1 /product="uncharacterized protein LOC106090929" /protein_id="XP_059223065.1" /db_xref="GeneID:106090929" /translation="MRAWEKPCPGENGFSEQAWHTNGNGGGPFFRLLVLGVLASLAVA DVKELSREYLPPKLESASVTLNQEYLPPTKLDIPEVQQDEVEDNNIEVPYVVQITRQG FPGAFPGAFPGSFPGAGGFPGAGGFPGAGGFPGAYPAYQGFPGAGYGGAGFPGQGFGF PGQGFGFPGQGFVNPGFGGAGFARPGFPGFGNYFSEQIKEEESNGDNGNSANNDLNLR DAPETEYDSTNGGYLYNKPAKTF" ORIGIN 1 atgagggcat gggagaaacc ctgccctggc gagaacggat tttccgagca agcctggcat 61 accaatggca atgggggagg tccgttcttc agattattgg tattgggagt tttggcgtct 121 ttggccgtgg ctgatgtcaa ggaattgtca cgagaatatc tgccacccaa gctggaaagt 181 gctagtgtca cattgaatca agaatacctg ccacccacca aattggacat tcccgaagtg 241 caacaggatg aggtggagga taataatatt gaagtgccct atgtagtgca aatcactagg 301 caaggctttc ccggtgcttt tcccggagcc ttccctggtt cattcccagg tgcaggaggc 361 ttccccggag cagggggctt ccccggagca ggaggcttcc ccggagccta tcctgcctat 421 caaggtttcc ccggtgccgg ttacggaggt gcaggtttcc ccggtcaagg ttttggtttt 481 cccggtcaag gtttcggttt ccccggccaa ggatttgtta atcccggatt tggcggtgca 541 ggtttcgctc gtcccggttt ccccggcttt ggcaactact tctccgaaca gatcaaggaa 601 gaggagtcca atggcgataa tggaaattct gccaacaacg atttgaattt gcgcgatgct 661 cctgaaaccg aatatgacag caccaatggt ggttatctct ataataaacc agccaagact 721 ttttaa