PREDICTED: Stomoxys calcitrans uncharacterized LOC106090929

LOCUS       XM_059367082             726 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090929), mRNA.
ACCESSION   XM_059367082
VERSION     XM_059367082.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..726
                     /gene="LOC106090929"
                     /note="uncharacterized LOC106090929; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106090929"
     CDS             1..726
                     /gene="LOC106090929"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090929"
                     /protein_id="XP_059223065.1"
                     /db_xref="GeneID:106090929"
                     /translation="MRAWEKPCPGENGFSEQAWHTNGNGGGPFFRLLVLGVLASLAVA
                     DVKELSREYLPPKLESASVTLNQEYLPPTKLDIPEVQQDEVEDNNIEVPYVVQITRQG
                     FPGAFPGAFPGSFPGAGGFPGAGGFPGAGGFPGAYPAYQGFPGAGYGGAGFPGQGFGF
                     PGQGFGFPGQGFVNPGFGGAGFARPGFPGFGNYFSEQIKEEESNGDNGNSANNDLNLR
                     DAPETEYDSTNGGYLYNKPAKTF"
ORIGIN      
        1 atgagggcat gggagaaacc ctgccctggc gagaacggat tttccgagca agcctggcat
       61 accaatggca atgggggagg tccgttcttc agattattgg tattgggagt tttggcgtct
      121 ttggccgtgg ctgatgtcaa ggaattgtca cgagaatatc tgccacccaa gctggaaagt
      181 gctagtgtca cattgaatca agaatacctg ccacccacca aattggacat tcccgaagtg
      241 caacaggatg aggtggagga taataatatt gaagtgccct atgtagtgca aatcactagg
      301 caaggctttc ccggtgcttt tcccggagcc ttccctggtt cattcccagg tgcaggaggc
      361 ttccccggag cagggggctt ccccggagca ggaggcttcc ccggagccta tcctgcctat
      421 caaggtttcc ccggtgccgg ttacggaggt gcaggtttcc ccggtcaagg ttttggtttt
      481 cccggtcaag gtttcggttt ccccggccaa ggatttgtta atcccggatt tggcggtgca
      541 ggtttcgctc gtcccggttt ccccggcttt ggcaactact tctccgaaca gatcaaggaa
      601 gaggagtcca atggcgataa tggaaattct gccaacaacg atttgaattt gcgcgatgct
      661 cctgaaaccg aatatgacag caccaatggt ggttatctct ataataaacc agccaagact
      721 ttttaa