PREDICTED: Stomoxys calcitrans uncharacterized LOC131996893

LOCUS       XM_059367080             999 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996893), mRNA.
ACCESSION   XM_059367080
VERSION     XM_059367080.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..999
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..999
                     /gene="LOC131996893"
                     /note="uncharacterized LOC131996893; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:131996893"
     CDS             1..999
                     /gene="LOC131996893"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996893"
                     /protein_id="XP_059223063.1"
                     /db_xref="GeneID:131996893"
                     /translation="MGNLPQVRLNPARPFKHSGLDYAGPINMKQNTLRRSTTTKGYIC
                     LFVCMCTKAVHLEVVSSLTTDDFLAAFKRFTSRRGPCTDLYSDCGTTFIGASKELQIL
                     YHRSKASLPEHLVEGLNNSGTQWHFIPPASPHFGGLWEAGVKSTKHHLRRIMKDRTLT
                     YEELSTLLCQVESCLNSRPLCPLSTDPSDFSVLTPAHFLVGEPTTCIPEDDLLDSNIN
                     RLTHWKQIEKLKQHFWQRWSQEYLCRLQSRPKWNCLKREAQIGDIVLLLHERSTPGHW
                     PLARVEEIHPGSDGHCRVVTLYCNGKFIKRPIAKICFLPSNDASSVTLNALEERNT"
ORIGIN      
        1 atgggaaatc taccacaagt gcgactcaat cctgcaaggc ccttcaaaca tagtggtcta
       61 gactatgctg gccctataaa tatgaagcaa aatacactca gacgaagcac cacaaccaaa
      121 gggtacatat gcttattcgt ttgcatgtgt accaaagctg ttcatcttga ggttgtttct
      181 agcttaacca ctgatgattt tctggctgca tttaagaggt tcacttctcg ccgaggacct
      241 tgtactgatt tgtactcgga ttgtggcaca acattcatcg gagcgtccaa agaactacag
      301 attttgtacc atagatccaa agcttcatta cctgaacatt tggtagaagg cctcaacaac
      361 agtggtaccc aatggcattt tatacctcct gcttcccctc attttggtgg tctatgggaa
      421 gcgggtgtga agtctacgaa gcatcatctt cgtcgtatta tgaaagaccg gactctcaca
      481 tacgaggaac tttcaaccct attgtgccaa gtcgaaagct gtttaaattc caggcctctt
      541 tgcccgctct caactgatcc ctcagacttc agcgttttga caccggccca tttcttagtt
      601 ggcgagccta caacttgtat accagaagac gacttgctag actcaaacat caatcggcta
      661 acacattgga aacagattga gaaacttaag caacattttt ggcaacgctg gtcccaagag
      721 tatctttgcc gattgcagtc aagaccaaaa tggaattgcc taaaacgaga ggcccaaatc
      781 ggtgatattg tactgctact tcatgaacgc agtaccccag gacattggcc attggctcga
      841 gtagaagaaa tacatcctgg ctctgacggg cactgtcgag ttgtgacctt gtattgcaat
      901 ggaaaattca taaagcgtcc aattgcaaaa atttgttttc tcccatccaa cgatgcatca
      961 tcagtcactt taaatgcttt ggaagaaaga aatacttga