Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367078 726 bp mRNA linear INV 02-SEP-2023 (LOC131996892), mRNA. ACCESSION XM_059367078 VERSION XM_059367078.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..726 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..726 /gene="LOC131996892" /note="uncharacterized LOC131996892; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996892" CDS 1..726 /gene="LOC131996892" /codon_start=1 /product="uncharacterized protein LOC131996892" /protein_id="XP_059223061.1" /db_xref="GeneID:131996892" /translation="MRDATAANVIRFLISEIFHKFGVPEVIHSDNGAQFISKSFQDMI SAYKITHMRTAVYSPQSNASERVNRSVISAIRTYLNEDHRDWDLYLSEIECALRTSVH SATGVTPFFSLFGYEMHSNGTDYKLARKLLSMSDHEISDLQRPDKLEMIREKVKRKTH EAYERSSERYNKRARVVRFLPGQEVYRRNTVSSDFAKDRNAKFCKKFLKCRIVRPVGN NMYELETLQGKTLGTYHVKDIQI" ORIGIN 1 atgcgtgatg ctactgctgc caatgttatt cgatttttaa taagtgaaat ttttcataaa 61 tttggtgtac cggaggtgat ccacagcgat aatggtgctc aattcatatc caaaagtttt 121 caagatatga tatctgctta taaaataacg catatgagaa ccgcagtgta ctcaccccaa 181 tccaatgctt ccgaacgtgt aaatcggtct gtcatatcgg ccataaggac atatttgaat 241 gaagaccatc gagattggga tctctactta tcggagatcg agtgcgctct tagaacatca 301 gtccattcgg caactggagt aacccctttc ttttcattat tcggttacga gatgcattct 361 aatggcacgg actataagtt ggcacggaaa ttgctatcca tgtccgatca tgagatatct 421 gatttacagc gaccggataa attggaaatg atcagagaga aggtgaaaag gaaaacgcat 481 gaggcatatg aaagaagttc tgagaggtat aataaacgag cacgcgtcgt tagattccta 541 cccggtcaag aagtatatcg ccgtaatact gtttcgtctg attttgctaa agatcgtaat 601 gccaaatttt gtaagaagtt tttgaagtgt cgaatcgtta gacctgtcgg caataacatg 661 tatgaacttg aaacattaca aggcaagacg ttaggtacgt atcatgttaa agatattcaa 721 atatag