PREDICTED: Stomoxys calcitrans uncharacterized LOC131996892

LOCUS       XM_059367078             726 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996892), mRNA.
ACCESSION   XM_059367078
VERSION     XM_059367078.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..726
                     /gene="LOC131996892"
                     /note="uncharacterized LOC131996892; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996892"
     CDS             1..726
                     /gene="LOC131996892"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996892"
                     /protein_id="XP_059223061.1"
                     /db_xref="GeneID:131996892"
                     /translation="MRDATAANVIRFLISEIFHKFGVPEVIHSDNGAQFISKSFQDMI
                     SAYKITHMRTAVYSPQSNASERVNRSVISAIRTYLNEDHRDWDLYLSEIECALRTSVH
                     SATGVTPFFSLFGYEMHSNGTDYKLARKLLSMSDHEISDLQRPDKLEMIREKVKRKTH
                     EAYERSSERYNKRARVVRFLPGQEVYRRNTVSSDFAKDRNAKFCKKFLKCRIVRPVGN
                     NMYELETLQGKTLGTYHVKDIQI"
ORIGIN      
        1 atgcgtgatg ctactgctgc caatgttatt cgatttttaa taagtgaaat ttttcataaa
       61 tttggtgtac cggaggtgat ccacagcgat aatggtgctc aattcatatc caaaagtttt
      121 caagatatga tatctgctta taaaataacg catatgagaa ccgcagtgta ctcaccccaa
      181 tccaatgctt ccgaacgtgt aaatcggtct gtcatatcgg ccataaggac atatttgaat
      241 gaagaccatc gagattggga tctctactta tcggagatcg agtgcgctct tagaacatca
      301 gtccattcgg caactggagt aacccctttc ttttcattat tcggttacga gatgcattct
      361 aatggcacgg actataagtt ggcacggaaa ttgctatcca tgtccgatca tgagatatct
      421 gatttacagc gaccggataa attggaaatg atcagagaga aggtgaaaag gaaaacgcat
      481 gaggcatatg aaagaagttc tgagaggtat aataaacgag cacgcgtcgt tagattccta
      541 cccggtcaag aagtatatcg ccgtaatact gtttcgtctg attttgctaa agatcgtaat
      601 gccaaatttt gtaagaagtt tttgaagtgt cgaatcgtta gacctgtcgg caataacatg
      661 tatgaacttg aaacattaca aggcaagacg ttaggtacgt atcatgttaa agatattcaa
      721 atatag