PREDICTED: Stomoxys calcitrans homeobox protein unc-4-like

LOCUS       XM_059367077             946 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083901), mRNA.
ACCESSION   XM_059367077
VERSION     XM_059367077.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..946
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..946
                     /gene="LOC106083901"
                     /note="homeobox protein unc-4-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106083901"
     CDS             1..876
                     /gene="LOC106083901"
                     /codon_start=1
                     /product="homeobox protein unc-4-like"
                     /protein_id="XP_059223060.1"
                     /db_xref="GeneID:106083901"
                     /translation="MQNSNAEDDDNQCNKSKRQRCRTNFNSWQLEELEKVFLCSHYPD
                     VGLQETLAFRLGLKQSRIAVWFQNRRAKWRKQENTKKGPGRPAHNSHPPTCSGEPIPW
                     EELQTKRKARLRKKIEKVIQRQARKLRMKGIEVNMDKLRAEYLAQHQLGDELSDTDEA
                     LIQVINENDEYDLQIDIVRNEDRSITMETDYYNSQSSMTNTTKETASVEDNHEANALQ
                     SNSNETDDDFDIELKFMPSYHDDHFKWNDLASTSDIKPNENNLNGNLIVKEEKKEDYK
                     RSIPFSIDYLLNYKT"
ORIGIN      
        1 atgcagaatt caaatgctga agatgatgac aaccaatgca acaagtccaa gcggcaaaga
       61 tgtcgcacta acttcaattc atggcaactg gaagaactgg aaaaggtctt cctatgcagt
      121 cattatccag atgtaggatt gcaggaaaca cttgccttta gattgggttt aaaacagagt
      181 cgaatagcgg tatggtttca aaatcgcaga gcaaagtggc gcaaacagga aaacaccaag
      241 aaaggaccag gacggccggc gcacaactcc catccgccca cttgttctgg agaacctata
      301 ccctgggagg aattacaaac caaaagaaaa gctcgactcc gcaaaaagat tgagaaagtc
      361 attcaaagac aagctaggaa attgcgcatg aaaggcattg aggtaaatat ggataaactt
      421 agagctgaat atcttgccca gcatcaacta ggcgatgagc tatccgatac cgatgaagcc
      481 ttaatacaag tcattaatga gaatgatgag tatgatttgc aaattgacat tgtgaggaat
      541 gaagatagaa gtattaccat ggaaacggat tattacaatt ctcaaagctc tatgactaac
      601 acaaccaaag agaccgcaag tgtggaagac aatcatgagg caaatgcatt acaatccaat
      661 agcaatgaga cagatgatga ctttgatatt gagctgaagt ttatgccatc ttatcatgat
      721 gaccatttca agtggaatga tttggcatcc accagtgata ttaagccaaa tgagaataat
      781 cttaatggaa accttattgt aaaggaggag aaaaaagaag attataagcg tagcatacct
      841 tttagcatag attatttatt gaattacaaa acatgagaga gacttactat gacttatatg
      901 tgaaaaattg caatcaataa cgaagaagaa aataagaatc ataata